+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Cabbage root fly - Interaction with fungal diseases, Section General Plant Pathology, Div. Plant Pathology and Crop Protection, ...
15742
Cabbage root fly - Interaction with fungal diseases, Section General Plant Pathology, Div. Plant Pathology and Crop Protection, ...
http://wwwuser.gwdg.de/~instphyt/app/research/cabbage-root-fly.html
Oilseed rape is an economically important crop in German agriculture. As a result of intensive cultivation, an increasing incidence of some brassica- related fungal diseases and pests has been observed recently.
Crops > Cabbage > Research
cabbage root fly plant pathology oilseed crop protection leptosphaeria maculans yield of rape fungal virology integrated control phytopathogenic bacteria
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Cabbage > Research
This Cabbage Cultivar Trial compared 10 cultivars using 3 replicates of each cultivar. Objectives were to evaluate performance and quality characteristics of cabbage cultivars for their suitability in a southern Ohio growing season.
Category:
For "Informational Use Only". For more detailed information, contact your health care provider about options that may be available for your specific situation.
Category:
>d1cbn__ 7.11.1.1.1 Crambin [abyssinian cabbage (Crambe abyssinica)] TTCCPSIVARSNFNVCRLPGTPEALCATYTGCIIIPGATCPGDYAN >d2erl__ 1.10.1.1.1 ER-1 [Euplotes raikovi] DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV >d8rxna_ 7.34.3.1.
Category:
Cabbage juice is placed in a large flask. Vinegar is added to the point of color change. Aqueous ammonia is then added to the point of color change. Vinegar is then added again to show the reversibility of the color change.
Category:
The secret to perfect pork chops is to start with a thicker center-cut loin chop. They are finished cooking when they are firm to the touch and their juices are slightly pink.
Category:
Chinese officials seeking to fight HIV are looking to make accessing condoms as common as buying cabbage. If people could get a condom as conveniently and naturally as buying a Chinese cabbage, the AIDS prevention function carried out by condoms could finally imbue people s lives and change their
Category:
Stedman's Medical Dictionary. Copyright © 2006 Lippincott Williams & Wilkins. All rights reserved.
Category:
A novel midgut peritrophic membrane (PM) protein, TnPM-P42, was identified from the cabbage looper, Trichoplusia ni. TnPM-P42 was shown as a 42kDa protein by SDS-PAGE analysis and appeared to be associated with the PM throughout its entire length. In T.
Category:
The familiar cabbage, a popular vegetable in many cultures, is a member of the cruciferous family of flowering plants that also includes the mustards and broccolis.
Category:
Keep the juice/oil. Set aside. Cut all pieces of stewing beef in half. Saute stewing beef in hot oil (quickly) until all sides are browned (Beef remains raw inside). Keep the juice/oil. Set aside. Season both onions and beef with a bit of salt/pepper before you saute.
Category:
