+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Pii: s1360-1385(00)01577-6.
15945
Pii: s1360-1385(00)01577-6.
http://www.sdsc.edu/~gribskov/papers/Harmon2000.pdf
The abundant calcium-stimulated protein kinase activity found in plant extracts is associated with CDPKs. These enzymes contain three functional domains14 : catalytic, autoinhibitory and calcium-binding (Fig. 1).
Crops > Carrot > Research
calmodulin-like domain calcium-dependent protein trends in plant science kinases kinase calmodulin spinach leaf calcium-binding properties
Jan 1, 2002
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
Research project: Chemical ecology and dispersal of the carrot psyllid, Trioza apicalis, Pheromone group, Ecology Department, Lund University, Sweden
Category:
2. New Page 1.
1| phytoene synthase 1 [Prunus armeniaca] FKDMIEGMRMDLRKSIYQNFDELYLYCYYVAGTVGLMSVPVMGISPESQATTESVYNAALALGIANQLTN ILRDVGEDARRGRIYLPQDELAQAGLSDSDIYAGKVTDKWRSFMKNQIKRARMFFDEAEKGVTELSEASR WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLALPIAYTKSLIRPSRTSSYSTRAQKTDSLTSK V
Category:
Department of Chemical and Biological Sciences, Japan Women's University, Tokyo, Japan. Previously, we cloned a carrot (Daucus carota L.) cDNA encoding a 45-kD protein, 21D7, located in the nuclei of proliferating cells.
Category:
Generated from scop database 1.69 with scopm 1.101 on Fri Jul 29 15:51:10 2005 Copyright © 1994-2005 The scop authors / scop@mrc-lmb.cam.ac.
Category:
Plants Names for Ethnobotany Project Final List By Linda Fendell Entry Common Names Scientific Names Family Name Species Name Family Name Species Name Horsetail Common Horsetail Equisetaceae Equisetum arvense L. Horsetail Common Horsetail Equisetaceae Equisetum telmatiea
Category:
737 Weed Technology. 2005. Volume 19:737743 A Common Ragweed (Ambrosia artemisiifolia) Biotype in Southwestern QueŽbec Resistant to Linuron1 SOPHIE SAINT-LOUIS, ANTONIO DITOMMASO, and ALAN K. WATSON2 Abstract: The degree of resistance to linuron of a common ragweed biotype was investigated.
Category:
wa.gov.au Cost $44 (including GST). Contents Session 1 AN OVERVIEW OF CURRENT AND FUTURE TRENS IN THE UK AND EUROPEAN CARROT INDUSTRIES P.T. Wright&&&&&&&&&&&&&&&&&&&&&&&&&&&&&...&&&.5 CARROT TRENDS IN NORTH AMERICA R.
Category:
2006 Pest Management Guide for Production and Maintenance of Herbaceous Perennials Herbaceous perennial crop production is important to the economic viability of New York State Agriculture.
Category:
0101 Dermatophagoides farinae American house dust mite mites IUISDer f 2.0102 Dermatophagoides farinae American house dust mite mites IUISDer f 2.
Category:
10. issue2.
Stress of mechanical damage (cutting) caused metabolic changes of phenol compounds in carrot. The level of soluble phenolics and responsible for the bitter taste isocoumarin increased in the root slices obtained by the crosswise cutting and stored for three days at room temperature.
Category:
