Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6289
Biology: 170

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26

+ Pagerank Statistics

PR 9
1 site(s)
PR 7
3 site(s)
PR 6
28 site(s)
PR 5
185 site(s)
PR 4
598 site(s)
PR 3
876 site(s)
PR 2
503 site(s)
PR 1
240 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.






Assessment of Phytoremediation as an In-Situ Technique.

15968 Assessment of Phytoremediation as an In-Situ Technique. http://www.ag.usask.ca/departments/scsr/research/phytorem.pdf farrell@sask.usask.ca germida@sask.usask.ca December 29, 1999 Assessment of Phytoremediation as an In-Situ Technique for Cleaning Oil-Contaminated Sites Prepared by: C.M. Frick, R.E. Farrell and J.J. Crops > Carrot > Research phytoremediation   hydrocarbons   microorganisms   contaminants   rhizosphere   situ   bioremediation   pyrene   root   exudates   phenanthrene   anthracene Jan 1, 2006  

Write a Review   Add to My Favorite   Refer it to Friend   Report Broken Link  

Average Visitor Rating: 0.00 (out of 5)
Number of ratings: 0 Votes

Visitor Rating



Other links at Crops > Carrot > Research

7600 Glover Road Langley, BC V2Y 1Y1 Canada U.S. Mail Address: PO Box 1409 Blaine, WA 98231-1409 Phone: 1.604.888.
Category:

CosmicVoyage Store: Gifts that connect you to the cosmos! A Cosmology Store!
Category:

1-5' tall biennial with a stout, edible taproot. Plant covered with bristly hairs. Flowers small and white, but made conspicuous by their arrangement in a flat-topped, tightly packed, 2-4" wide umbel (often with a single pink or purple floret in the center). Leaves twice compound.
Category:

¼0>0@0“ÊÆ==ùKÑ€•(Ficus microcarpa L. f. var. pusilifolia Liao cv. Kin-men) -I•(Ficus microcarpa L. f. cv. Middle-leaf)ÊOq0@KI•(Ficus microcarpa L. f. var.
Category:

[exit DNR], a Web site presented by the Wisconsin Herbarium, to view photos and learn more about these plant species, as well as the rest of Wisconsin's Flora.
Category:

House U.S. Embassy Beijing Prepared by: Adam Branson Report Highlights: China's Ministry of Agriculture revised the list of plants eligible for new plant variety protection (new PVP) on May 20, 2005 by including 21 additional varieties. The list updates information contained in CH4059.
Category:

bstract. The ABA INSENSITIVE1 (ABI1) and ABI2 genes encode homologous type-2C protein phosphatases with redundant yet distinct functions in abscisic acid (ABA) responses.
Category:

The properties of a digital modeling of signal transduction networks and the potential benefits of this method for creating a computer database of plant signaling events within a â¬Üdigital plantâ¬" project are presented.
Category:

1| phytoene synthase 1 [Prunus armeniaca] FKDMIEGMRMDLRKSIYQNFDELYLYCYYVAGTVGLMSVPVMGISPESQATTESVYNAALALGIANQLTN ILRDVGEDARRGRIYLPQDELAQAGLSDSDIYAGKVTDKWRSFMKNQIKRARMFFDEAEKGVTELSEASR WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLALPIAYTKSLIRPSRTSSYSTRAQKTDSLTSK V
Category:

This is a discussion forum powered by vBulletin. To find out about vBulletin, go to http://www.vbulletin.com/ .
Category:





Valid XHTML 1.0 Transitional   Valid CSS