+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Structural and functional divergence of insect CYP6B proteins: From...
15985
Structural and functional divergence of insect CYP6B proteins: From...
http://www.scs.uiuc.edu/~jerome/publis/Li_PNAS_04.pdf
Structural and functional divergence of insect CYP6B proteins: From specialist to generalist cytochrome P450 Xianchun Li* , Jerome Baudry! , May R. Berenbaum*§ , and Mary A.
Crops > Carrot > Research
vertical channel indole-3-carbinol access plant allelochemicals catalytic xanthotoxin defense side families site
Jan 1, 2004
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
1. New Page 1.
1| phytoene synthase 1 [Prunus armeniaca] FKDMIEGMRMDLRKSIYQNFDELYLYCYYVAGTVGLMSVPVMGISPESQATTESVYNAALALGIANQLTN ILRDVGEDARRGRIYLPQDELAQAGLSDSDIYAGKVTDKWRSFMKNQIKRARMFFDEAEKGVTELSEASR WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLALPIAYTKSLIRPSRTSSYSTRAQKTDSLTSK V
Category:
Albostrians mutant: chloroplast-nucleus interactions We have been analysing the interactions between the three DNA-containing compartments of plant cells: nucleus, chloroplasts (plastids) and mitochondria. Main subject of our studies has been the barley (Hordeum vulgare L.
Category:
Metabolic engineering to increase isoavone biosynthesis in soybean seed Oliver Yu1 , June Shi, Aideen O. Hession, Carl A. Maxwell, Brian McGonigle*, Joan T. Odell E.I. du Pont de Nemours & Company, Inc.
Category:
eneldo GARDENMOSAICS www.gardenmosaics.org GARDENMOSAICS www.gardenmosaics.org LA FAMILIA DE LA ZANAHORIA Página de ciencias APIACEAE (OR UMBELLIFEREAE) El nombre Umbellifereae se deriva de una palabra en latín que signica umbroso , que tiene sombra o la causa .
Category:
Le contrôle biologique des ravageurs peut impliquer un grand nombre d'organismes vivants tels que des oiseaux insectivores, des microorganismes et des insectes bénéfiques. Or, il est possible d'aménager le verger de façon à favoriser le travail de ces précieux auxiliaires.
Category:
This issue was published in the FEDERAL REGISTER of February 17, 1955 (20 FR 1010) to become effective March 20, 1955. Voluntary U.S. grade standards are issued under the authority of the Agricultural Marketing Act of 1946, which provides for the development of official U.S.
Category:
WILD CARROT, Daucus carota L. 1, entire plant; 2, flower head; 3, head in seed; 4, seed. Biennial, reproducing by seeds. In first year, produces rosette of finely divided leaves and fleshy taproot; in second year blooms and dies.
Category:
8. Hh-i-3.
--- AAGAAGEN A.adeninivorans GAA gene for glucoamylase. --- (2769 bases) |SCO: 1.15|POS:2253-2378|MIS: 0|WOB: 1| |AGC|GAA|GU|.. 80 nuc ..|AC|C|ACA|CUCCUUCUUCUGGCCACA|UGU|CUGAAGA|GUU| --- AB005230 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone: MAC12, --- (74613 bases) |SCO: 1.
Category:
A well-planned butterfly garden becomes a small but representative sample of the surrounding habitat and as such provides a safe haven for butterflies and other wildlife to gather, seek shelter, acquire food and water, and reproduce.
Category:
Native plants in the Matanuska-Susitna Valley grow either in natural ecosystems or in remnant lands interspersed in residential or farm lands. In 2004, diseased wild celery, Angelica lucida L., was diagnosed with an unknown plant virus near crops, wooded l...
Category:
