+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
305124.pmd.
15998
305124.pmd.
http://plant.lib.umn.edu/Aurora%202003.pdf
Aurora Sporealis The Alumni News Magazine of Plant Pathology Legacy of Excellence Issue Art on Campus - The Bulls A New Saint Paul Landmark 2003 Dear Alumni and Friends: This is the The Legacy of the Department of Plant PathologysAlumni News Magazine, The Aurora Sporealis.
Crops > Carrot > Research
plant pathology stem rot genomics soybean cyst nematode fusarium pathogens yield losses pathologists gene-for-gene host-parasite interactions
Jan 1, 2006
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Category:
INVASIVE PLANT SPECIES--COMPILED FROM VARIOUS LISTS genus species common name PAINT protocol for control Why introduced?
Category:
5 m away from the treated wood (<3 10 mg kg 1 As). Four replicates of carrot (Daucus carota var. sativus Hoffm. cv. Thumbelina), spinach (Spinacia oleracea L. cv. Indian Summer), bush bean (Phaseolus vulgaris L. cv. Provider), and buckwheat (Fagopyrum esculentum Moench cv.
Category:
OG Mitochondrion OX NCBI_TaxID=4039; XX FH Key Location/Qualifiers FH FT source 1..786 FT /organism="Daucus carota" FT /organelle="mitochondrion" FT /strain="ssp.
Category:
Candidatus Phytoplasma asteris, a novel phytoplasma taxon associated with aster yellows and related diseases I.-M. Lee,1 D. E. Gundersen-Rindal,2 R. E. Davis,1 K. D. Bottner,1 C. Marcone3 and E. Seemu¨ller4 Correspondence I.-M. Lee leeim@ba.ars.usda.
Category:
BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Category:
Globe Artichokes - Cynara scolymus - edible phyllaries and receptacle - hairy 'chaff' on the receptacle ('choke') is often found in other 'thistles' of the group (tribe) that also features the discoid inflorescence.
Category:
PUBLISHED PAPERS RELATING TO CARROT (Daucus carota L.) (in date order) Davey, J.C., Horgan, G.W. & Talbot, M. 1997 Image analysis: a tool for assessing plant uniformity and variety matching. In: Proceedings of the fifth meeting of the EUCARPIA Carrot Working Group. Krakow.
Category:
Look for the following new flowers and vegetables online at e-commerce seed sales websites, in mail order seed catalogs, as seed packets in retail stores, or as bedding plants at garden centers. The varieties are first sorted by flowers and vegetables, and then listed alphabetically by class.
Category:
Efeito da radiação solar sobre o acúmulo de matéria seca e teores de nitrogênio, potássio e cálcio ... Effect of global solar radiation on dry matter accumulation and uptake of N ... - Augusto Tayoshi, João Alexandre Galon...
Category:
