+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Structural and functional divergence of insect CYP6B proteins: From specialist to generalist cytochrome P450 -- Li et al. 101 ...
16044
Structural and functional divergence of insect CYP6B proteins: From specialist to generalist cytochrome P450 -- Li et al. 101 ...
http://www.pnas.org/cgi/content/full/101/9/2939
How polyphagous herbivores cope with the diversity and unpredictability of plant defenses remains largely unknown at both the genetic and molecular levels.
Crops > Carrot > Research
plant allelochemicals vertical channel access catalytic indole-3-carbinol site p450 reductase xanthotoxin families defense
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
Origin and Distribution: Wild carrot is native to Europe. It entered the United States about 250 years ago, probably as a contaminant of cultivated carrot seeds, and was reported in Canada about 150 years later. It has since spread throughout most of North America.
Category:
A. Fibrous root system of rip-gut grass (Bromus diandrus). B. Tap root of a carrot (Daucus carota). C. Fascicled (clustered) storage roots of sweet potato (Ipomoea batatas).
Category:
Protection against Weapons of Mass Destruction Month year Project no. February 2004 E46052 General Research Areas 5. Commissioned research Subcategories NBC Defence SE-901 82 Umeå 39.
Category:
Psila rosae; Carrot Root Fly The carrot root fly is a known pest of the plant family Apiaceae. This family comprises: Daucus carota; Carrot. Apium graveolens; Celery. Pastinaca sativa; Parsnip. Apium graveolens rapaceum; Celeriac. Petroselinum hortense; Parsley. Anthriscus cerefolium; Chervil.
Category:
>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Category:
Daucus carota (Carrot) has become naturalised in a few places. It is a medium sized, erect herb with bipinnate leaves and flowers in large compound umbels.
Category:
The abundant calcium-stimulated protein kinase activity found in plant extracts is associated with CDPKs. These enzymes contain three functional domains14 : catalytic, autoinhibitory and calcium-binding (Fig. 1).
Category:
PMIF publications since 1990 Prof. Robert G Birch Page 1 of 8 PLANT MOLECULAR IMPROVEMENT FACILITY Botany Department, School of Integrative Biology, The University of Queensland Publications since 1990 International Refereed Journal Articles Hashimi, S., Wall, M., Smith, A.B., Maxwell, A.
Category:
9. nfnotas15.
39TEMAS | septiembre - diciembre 2001 Notas Resumen El ajo (Allium sativum L.), es una especie hortícola de gran importancia en Cuba por su alta demanda por la población tanto con fines culinarios como medicina- les.
Category:
10. Asterid II lab.
I. This laboratory is designed for you to identify members of the Asteraceae (Compositae). Refer to Plant Systematics pp. 326-331 and Zomlefer pp. 203 - 211 to become familiar with this family.
Category:
