+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Rachel's Folly cover.
16146
Rachel's Folly cover.
http://www.cei.org/pdf/1455.pdf
NATURES HORMONE FACTORY ENDOCRINE DISRUPTERS IN THE NATURAL ENVIRONMENT JonathanTolman March 1996 ISSN#1085-9047 For millions of years plants have been quietly producing chemicals. Through countless generations they have been perfect- ing a potpourri of chemicals, some benign some deadly.
Crops > Carrot > Research
cottonseed oil phytoestrogens estrogenic effects human diet endocrine disrupters synthetic estrogen soybean clover
Jan 1, 2004
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
. 7 Results &&&&&&&&&&&&&&&&&&&&&&& 8 Result Graphics (Figures 1-6) &&&&&&&&&&&&&&. 17 Discussion &&&&&&&&&&&&&&&&&&&&&..
Category:
>d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi} attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
Category:
474 The Ohio Naturalist. [Vol. XII, No. 4, THE DIURNALINODDING OF THE WILD CARROT AND OTHER PLANTS. JOHN H. SCHAFFNER. Many plants exhibit periodical movements during the twenty- four hours of a day.
Category:
Ultimately, when a plant flowers is determined by its genetics. However, its environment, particularly light and temperature, often can promote or delay flowering. Plant age also often has a major effect on the ability of a plant to flower.
Category:
Universidade Federal Rural do Rio de Janeiro, Departamento de Química and Departamento de Solos, Rodovia Rio-São Paulo km 47, Seropédica, RJ, CEP 23851-000, Brazil;
Category:
CSL/JIFSAN 28-30 June 2005 Slide 6 Queen Annes Lace Daucus carota - Wild Carrot
Category:
Principal Researcher Name: Jameel M. Al-Khayri College: Agriculture and Food Sciences Department: Date Palm Research Center Co-Researcher Name: Abdulaziz M. Al-Bahrany College: Agriculture and Food Sciences Department: Horticulture 2.
Category:
Accession Numbers for CRKs Listed in Alignment Figure (from Calcium-Dependent Protein Kinases and Their Relatives, Advances in Botanical Research, Volume 32, M. Kreis and J. C. Walker (eds.) Species CRK name Accession Number cDNA Genomic Arabidopsis thaliana (mouse-eared
Category:
Ibrahim MA, Oksanen EJ, Holopainen JK. Effects of limonene on the growth and physiology of cabbage (Brassica oleracea L) and carrot (Daucus carota L) plants. J Sci Food Agric 2004:84:1319-1326.
Category:
gi|15240922|ref|NP_198663.1| DNA repair protein RAD23, putative [Arabidopsis thaliana] gi|9758825|dbj|BAB09359.1| DNA... Match: gi|30409726|dbj|BAC76393.1| score: 335.5 e-value: 1.5e-90 Identity: 75.7% Span: 744bp (44.
Category:
