+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
1.100.1 3.5.4 4.33.1|ch60_actac|546|1 1|1#|1.100.1 4.33.1 3.5.4...
16227
1.100.1 3.5.4 4.33.1|ch60_actac|546|1 1|1#|1.100.1 4.33.1 3.5.4...
http://bioinfo.mbb.yale.edu/partslist/func/multidom/new_combo_wmultidomcoverage_wlen_wcode.lst
1.100.1 3.5.4 4.33.1|CH60_ACTAC|546|1 1|1#|1.100.1 4.33.1 3.5.4 4.33.1 1.100.1|60 KD CHAPERONIN (PROTEIN CPN60) (GROEL PROTEIN) 1.100.1 3.5.4 4.33.1|CH60_ACTPL|546|1 1|1#|1.100.1 4.33.1 3.5.4 4.33.1 1.100.1|60 KD CHAPERONIN (PROTEIN CPN60) (GROEL PROTEIN) 1.100.1 3.5.4 4.33.
Crops > Carrot > Research
glyceraldehyde 3-phosphate dehydrogenase guanine nucleotide-binding protein alpha chain histocompatibility antigen elongation factor glutathione s-transferase ribulose bisphosphate carboxylase nucleoti
Jan 1, 2001
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
Query sequence: S39K5 (611 letters) Database: ./db/nr 2,304,535 sequences; 784,226,776 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM81202.1| calmodulin 1 [Medicago truncatula] >gi|5825598|gb...
Category:
- 173 - EVALUATION OF FUNGICIDES FOR SUPPRESSING ALTERNARIA LEAF BLIGHT OF CARROT D. B. Langston, Jr. University of Georgia Cooperative Extension Department of Plant Pathology Tifton, GA 31793 dlangsto@uga.
Category:
The Open Book page image presentation framework is not designed to replace printed books. Rather, it is a free, browsable, nonproprietary, fully and deeply searchable version of the publication which we can inexpensively and quickly produce to make the material available worldwide.
Category:
A calmodulin-like domain protein kinase (DcCPK1, previously designated CDPK431) cloned from carrot (Daucus carota L.) was expressed at high levels in Escherichia coli and partially purified.
Category:
AC: RSP00001//OS: tomato (Lycopersicon esculentum) /GENE: pds/RE: Pds/Le element /BF: unknown nuclear factor 2. AC: RSP00002//OS: Brassica napus /GENE: Oleosin/RE: ABRE-3 /BF: B.napus embryo protein factor 3.
Category:
Endoscopic measurement of pancreatic juice secretory flow rates and pancreatic secretory pressures after secretin administration in human controls and in patients with acute relapsing pancreatitis, chronic pancreatitis, and pancreatic cancer.
Category:
7. Bumble Bee.
6 Natural History Project Biology 215 Jenna Pariseau Simpsons Point November 23, 2004 Table of Contents Site Description&&&&&&&&&&&&&.1 Animals&&&&&&&&&&&&&&&&&.2 1. Blue Heron (Ardea herodias)&&&&&&&&&3 2.
Category:
>P83218|PME_DAUCA Pectinesterase - Daucus carota (Carrot). QSSTVTPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIM FLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVG SDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSG
Category:
0101 Dermatophagoides farinae American house dust mite mites IUISDer f 2.0102 Dermatophagoides farinae American house dust mite mites IUISDer f 2.
Category:
The actin network is organized differently during division but it does not disappear as do the cortical microtubules. RLP stains a central filamentous cortical band as the chromatin begins to condense (preprophase); it stains the mitotic spindle (as recently shown by Seagull et al. [Seagull, R.
Category:
