+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6596
Categories: 68
Registered Users: 86
Mailing List Subscribers: 19
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
>K0_1 No match I:0 Q:0 S:0 Full:0...
16234
>K0_1 No match I:0 Q:0 S:0 Full:0...
http://www.bio.aau.dk/download/biotechnology/je/genomics/kuras-unigene122006.fsa
>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Crops > Carrot > Research
mouse-ear cress arabidopsis thaliana solanum protein n hypothetical oryza sativa medicago truncatula lycopersicon esculentum
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
wa.gov.au Cost $44 (including GST). Contents Session 1 AN OVERVIEW OF CURRENT AND FUTURE TRENS IN THE UK AND EUROPEAN CARROT INDUSTRIES P.T. Wright&&&&&&&&&&&&&&&&&&&&&&&&&&&&&...&&&.5 CARROT TRENDS IN NORTH AMERICA R.
Category:
2. Carrot.
The carrot is a variable annual or biennial plant from 1 to 3 feet tall with branching stems, fern-like leaves, and tiny white flowers that may turn purple in the center.
Category:
Polyamine biosynthesis Polyamine metabolism Polyamines Functions Polyamine in plant growth and development Polyamines and ethylene Polyamines and somatic embryogenesis
Category:
Discover Life's encyclopedia page about the biology, natural history, ecology, identification and distribution of Discover Life -- Carrot, Daucus carota image
Category:
bpg000270global_homology 3 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.- bpg000275global_homology 2 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.
Category:
Promotive effect of brassinosteroids on cell division involves a distinct CycD3-induction pathway in Arabidopsis Yuxin Hu, Fang Bao and Jiayang Li* Institute of Genetics, Chinese Academy of Sciences, Beijing 100101, China Received 29 August 2000; accepted 29 September 2000.
Category:
!!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383 February 19, 1999 15:06 REFORMAT of: seq.seq check: 4199 from: 1 to: 383 February 19, 1999 15:04 (No documentation) TO: SwissProt:* Sequences: 71,248 Symbols: 25,831,459 Word Size: 2 Databases searched: SWISS-PROT, Release 35.
Category:
ID AJ890364 preliminary; circular genomic DNA; VRL; 407339 BP. XX AC AJ890364; XX SV AJ890364.1 XX DT 16-MAR-2005 (Rel. 83, Created) DT 16-MAR-2005 (Rel. 83, Last updated, Version 0) XX DE Emiliania huxleyi virus isolate EhV86 XX KW complete genome.
Category:
Spis publikacji prof. dr hab. Krystyna Tylkowska Oryginalne prace twórcze: Tylkowska K. 1984. Wystpowanie grzybów na nasionach fasoli reprodukowanych w ró|nych rejonach Polski. Biuletyn Instytutu Hodowli i Aklimatyzacji Ro[lin, 153: 185-202. Tylkowska K. 1984.
Category:
10. mb232820.dvi.
Pro- phylactic therapy based on oral administration of human autoantigens is not, however, feasible when sufcient quantities of candidate autoantigens are not available.
Category:
