+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Universita'degli Studi di Pisa: Mappa Virtuale. Lorenzi Roberto - attivita'di ricerca.
16250
Universita'degli Studi di Pisa: Mappa Virtuale. Lorenzi Roberto - attivita'di ricerca.
http://virmap.unipi.it/cgi-bin/virmap/vmibo?docenti:8134391;listapubblicazioni;pubbl_elem
bstractThree kinds of explants from tubers cv Monalisa were analysed to investigate the time course of free and conjugated indole-3-acetic acid (IAA) concentrations, from the last period of tuber growth until sprouting, under two storage temperatures.
Crops > Carrot > Research
lingua solanum tuberosum l dormancy indole-3-acetic acid suspensor potato tuber indoleacetic sprouting bolting nucellus
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
1. á¤ÃÍ·.
Roman tombstone of a racehorse trainer in the Capitoline Museums (CIL 6.10069 = ILS 5295). It brags about the many times the horse won. Good photo, inscription transcribed, translated, commented.
Category:
Vacuolar ATPases (V-ATPases) are large complex enzymes that are structural and mechanistic relatives of F1Fo-ATPases (for reviews, see Bowman and Bowman, 1996; Dow, 1999; Finbow and Harrison, 1997; Forgac, 1999; Graham and Stevens, 1999; Kakinuma et al., 1999; Kane, 1999; Margolles- Clark et al.
Category:
Transiente Mikrokompartimentierung des pflanzlichen Primärstoffwechsels am Zytoskelett Inaugural-Dissertation zur Erlangung des Doktorgrades des Fachbereiches Biologie/Chemie an der Universität Osnabrück vorgelegt von Anke Scholz, geb.
Category:
Harmful Non-Indigenous Species in the United States September 1993 OTA-F-565 NTIS order #PB94-107679 GPO stock #052-003-01347-9 Recommended Citation: U.S. Congress, Office of Technology Assessment, Harmful Non-Indigenous Species in the United States, OTA-F-565 (Washington, DC: U.S.
Category:
Flowers: 1/8" wide, creamy white in flat topped compound umbels with feathery green collar, lacy, with purple to black flower in center, imperfect Fruit: spiny, in dried seed-heads, oblong and flattened Habitat: fields, meadows, roadsides, open woods
Category:
During plant development, the cell wall is subjected to precise regulation. During this process a bidirectional information exchange between the cell wall and the protoplast is observed.
Category:
June 10, 2003 Are you growing carrots in your nursery? For most of you, the answer is probably YES!. We are going to focus on 3 plants in the carrot family this week (some call it the parsley family).
Category:
A calmodulin-like domain protein kinase (DcCPK1, previously designated CDPK431) cloned from carrot (Daucus carota L.) was expressed at high levels in Escherichia coli and partially purified.
Category:
Alignment gi|4127741|emb|CAA07244.1| carrot chalcone synthase 1naringenin-chalcone synthase [Daucus carota]gi|12229621|sp|Q9ZS41|CHS1_DAUCA Chalcone synthase 1(Naringenin-chalcone synthase 1) (DcCHS1) Query: 17 HEVGLAQLPPAPPTTVAVIEGLATGTPRRVVNQSDAADRVAELFLDPGQRERIPRVY 73 +E AQ P T +A+ T TP V+QS AD
Category:
