+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
µá¯¿´¿¹ å࿲¿»®â ±¹ä®ãµé½ ¬´µ¹±â çá®ã·â ¼· ²¹¿»¿³¹ºî½ ãàìáé½ ãà¿á¬â º±¹ º¿½´í»é½ à±ä¬ä±â ...
16424
µá¯¿´¿¹ å࿲¿»®â ±¹ä®ãµé½ ¬´µ¹±â çá®ã·â ¼· ²¹¿»¿³¹ºî½ ãàìáé½ ãà¿á¬â º±¹ º¿½´í»é½ à±ä¬ä±â ...
http://www.minagric.gr/greek/data/%F0%E5%F1%DF%EF%E4%EF%E9%20%F3%F0%EF%F1%DC%F2.doc
µÁ¯¿´¿¹ ÅÀ¿²¿»®Â ±¹Ä®ÃµÉ½ ¬´µ¹±Â ÇÁ®Ã·Â ¼· ²¹¿»¿³¹ºÎ½ ÃÀÌÁɽ ÃÀ¿Á¬Â º±¹ º¿½´Í»É½ À±Ä¬Ä±Â º±Ä¬ ÆÅĹºÌ µ¯´¿Â ‘. ¦ÅĬ ¼µ³¬»·Â º±»»¹Á³µ¹±Â I.Beet 1 Beta vulgaris L.
Crops > Carrot > Research
brassica oleracea beta vulgaris l pisum sativum daucus carota napus lolium multiflorum lam phaseolus trifolium
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
Contents: 1. Standardisation of propagation techniques by cutting of some tropical fruit crops/S.K. Mitra & T.K. Bose. 2. Response of varying concentrations of boron in yield and quality of grapes (Vitis vinifera L.)/B. Singh & P. Rethy. 3. Biochemical changes in litchi (cv.
Category:
APIACEAE/UMBELLIFERAE Notes: Perhaps with more than any other family of wild greens, extreme caution and expertise is necessary in foraging. Several of the most poisonous species of wild greens that grow in the U.S.
Category:
Leaf Blight (fungus - Alternaria dauci) Infection occurs mostly on older leaves, but younger leaves may also become infected. Leaf blight first appears as indefinite brown to black areas with pale yellow centers. Infected leaves shrivel when infection is heavy [Photo #1].
Category:
4. Profile.
Nair's laboratory, the Bioactive Natural Products and Phytoceuticals Laboratory at Michigan State University, is engaged in the discovery, isolation, and identification of phytoceuticals that are potential candidates to be evaluated as phytomedicines.
Category:
O objetivo desta pesquisa foi determinar o coeficiente de cultura e a evapotranspiração máxima (ETm) da cenoura (Daucus carota, L.), variedade Nantes Superior, nos diversos subperíodos de desenvolvimento.
Category:
6. New Page 1.
1| phytoene synthase 1 [Prunus armeniaca] FKDMIEGMRMDLRKSIYQNFDELYLYCYYVAGTVGLMSVPVMGISPESQATTESVYNAALALGIANQLTN ILRDVGEDARRGRIYLPQDELAQAGLSDSDIYAGKVTDKWRSFMKNQIKRARMFFDEAEKGVTELSEASR WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLALPIAYTKSLIRPSRTSSYSTRAQKTDSLTSK V
Category:
'Bu tu gaisgeach na misnich Dol air astar na fiosachd, Is tu nach siubhladh air criplich, Ghabh thu steud briain Micheil, E gun chabstar na shliopan, Thu mharcachd air iteig, Leum thu thairis air fiosrachadh Naduir.'
Category:
Molecular and Cellular Biochemistry 123:159-166,1993. 9 1993Kluwer Academic Publishers. Printed in the Netherlands. Characterization of the non-specific lipid transfer protein EP2 from carrot (Daucus carota L.) Ellen A. Meijer, 1Sacco C. de Vries, 1Peter Sterk, ~ Dorus W.J. Gadella Jr.,2 Karel W.A.
Category:
Ainsworth, E. A., Davey, P. A., Hymus, G. J., Osborne, C. P., Rogers, A., Blum, H., Nosberger, J., and Long, S. P. Is stimulation of leaf photosynthesis by elevated carbon dioxide concentration maintained in the long term?
Category:
The carrot (Daucus carota) is a member of the Apiaceae (formerly Umbelliferae), the parsley family). Carrots are biennial plants, but they are grown as an annual crop and harvested for the enlarged taproot.
Category:
