Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
176 site(s)
PR 4
611 site(s)
PR 3
861 site(s)
PR 2
522 site(s)
PR 1
199 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.






Biology WorkBench 3.0 - CLUSTAL_W.

16440 Biology WorkBench 3.0 - CLUSTAL_W. http://life.nthu.edu.tw/~b861640/hk9/CLUSTAL.html OS CICER ARIETINUM (CHICKPEA) (GARBANZO)., OS ORYZA SATIVA (RICE)., OS DAUCUS CAROTA (CARROT)., OS PRUNUS DULCIS (ALMOND) (PRUNUS AMYGDALUS)., OS BETA VULGARIS (SUGAR BEET)., OS GOSSYPIUM HIRSUTUM (UPLAND COTTON)., OS SPINACIA OLERACEA (SPINACH)., OS LYCOPERSICON ESCULENTUM (TOMATO). Crops > Carrot > Research phylogeny   inference   package   gossypium   hirsutum   cicer   arietinum   upland   cotton   spinacia   oleracea   daucus   carota   lipid   transport   beta   vulgaris   common   tobacco   specific   gap   penalties Jan 1, 2000  

Write a Review   Add to My Favorite   Refer it to Friend   Report Broken Link  

Average Visitor Rating: 0.00 (out of 5)
Number of ratings: 0 Votes

Visitor Rating



Other links at Crops > Carrot > Research

© 2006 Ruhlman et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.
Category:

Carrots are a cool season crop. They are grown for their fleshy, and tasty storage roots. The carrot is native to Europe and parts of Asia. The carrot is mentioned in some ancient Greek writings; however, the carrot we know is relatively new due to improvements by plant breeding.
Category:

All items for the Chronicle Calendar should be submitted (typewritten, double spaced) by campus mail, U.S. mail or in person to Chronicle Calendar, Cornell News Service, Surge 3, Judd Falls Road.
Category:

Recrystallisation inhibition (RI) activity has been isolated from cold-acclimated Forsythia suspensa bark and leaves, which is stable when boiled, and not sensitive to reducing agents.
Category:

This process, known as cold acclimation, is briey reviewed from the perception of cold, through transduction of the low-temperature signal to functional analysis of cold-induced gene products.
Category:

>d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi} attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
Category:

Description : I keep intending to learn the distinguishing features of "common white umbelliferous things" so here's a start at it.
Category:

This food may eventually be used by the root itself, but more often the stored food is later mobilized and transported back through the phloem to the above-ground parts of the plant at a time when it is needed.
Category:

Yates EA, Valdor J-F, Haslam SM, Morris HR, Dell A, Mackie W, Knox JP (1996) Characterization of carbohydrate structural features recognized by anti-arabinogalactan-protein monoclonal antibodies.
Category:

A & B = initiation of lateral root through repeated local periclinal cell divisions in pericycle. The first stage of the lateral root initiation is the start of meristematic activity and the enlargement of a few initial pericyclic cells ("founder cells").
Category:





Valid XHTML 1.0 Transitional   Valid CSS