+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
MEROPS - the peptidase database.
16443
MEROPS - the peptidase database.
http://merops.sanger.ac.uk/cgi-bin/speccards?sp=sp002359&type=P
Daucus carota TAXONOMY Taxonomy database identifier: 4039 Superkingdom Eukaryota Kingdom Plantae Subkingdom Viridiplantae Phylum Tracheophyta Subphylum Spermatophytina Superclass Angiospermae Class Magnoliopsida Subclass Rosidae Order Apiales Family Apiaceae Genus Daucus Species
Crops > Carrot > Research
peptidase daucus carota homologues homologue subkingdom subphylum phylum peptidases subfamily
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
bstract Leaching of arsenic (As) from chromated copper arsenate (CCA)-treated wood may elevate soil arsenic levels. Thus, an environmental concern arises regarding accumulation of As in vegetables grown in these soils.
Category:
Agripedia is a interactive multimedia instructional resource about agriculture. Agripedia present facts, figures, demonstrations, examples, graphics, practices, and vocabulary of agriculture in a multimedia format using audio clips, graphics, text and animation.
Category:
Discover Life's encyclopedia page about the biology, natural history, ecology, identification and distribution of Discover Life -- Carrot, Daucus carota image
Category:
Alignment gi|4127741|emb|CAA07244.1| carrot chalcone synthase 1naringenin-chalcone synthase [Daucus carota]gi|12229621|sp|Q9ZS41|CHS1_DAUCA Chalcone synthase 1(Naringenin-chalcone synthase 1) (DcCHS1) Query: 17 HEVGLAQLPPAPPTTVAVIEGLATGTPRRVVNQSDAADRVAELFLDPGQRERIPRVY 73 +E AQ P T +A+ T TP V+QS AD
Category:
This Weeks Citation CIassiC~ ~ 1 Halperln W & Wethereil D F. Adventive embryony in tissue cultures of the wild carrot, Daucus carota. Amer. I. Bot. 51:274-83, 1964.
Category:
The quality of organic produce is of main interest to organic producers, distributers and consumers. The aim of this projectis to study the differences between organic and conventional carrots (Daucus carota L.).
Category:
7. kap3.
.................................................1 1. The process of domestication of crop plants..............................................................................4 1.1. Definition of domestication.............................................................................
Category:
Nitra, 2006 Dizerta
ná práca bola vypracovaná v externej forme doktorandského atúdia na Katedre skladovania a spracovania rastlinných produktov Fakulty biotechnológie a potravinárstva Slovenskej po>nohospodárskej univerzity v Nitre. Doktorand: Martina Fikselová, Ing.
ná práca bola vypracovaná v externej forme doktorandského atúdia na Katedre skladovania a spracovania rastlinných produktov Fakulty biotechnológie a potravinárstva Slovenskej po>nohospodárskej univerzity v Nitre. Doktorand: Martina Fikselová, Ing.
Category:
D Puchooa, Faculty of Agriculture, University of Mauritius, Réduit, Mauritius. R Ramburn, Faculty of Agriculture, University of Mauritius, Réduit, Mauritius.
Category:
BLASTP 2.2.9 [May-01-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Category:
