+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6596
Categories: 68
Registered Users: 86
Mailing List Subscribers: 19
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Crownvetch.
16591
Crownvetch.
http://www.colostate.edu/Depts/SoilCrop/extension/CSGA/CSGA/crownvetch.htm
The General Seed Certification Standards, as adopted by the Colorado Seed Growers Association, are basic, and together with the following specific standards, constitute the standards for certification of Crownvetch.
Crops > Carrot > Research
weed seeds noxious buckhorn plantain daucus carota apocynum cannabinum productive life russian knapweed wild carrot sweet clover objectionable
Jan 1, 2005
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
Read all the latest from the Chem / Bioinformatics world in the SelectScience.net Chem / Bioinformatics community
Category:
Appearance:Biennial herbaceous plant, 3 - 4' tall, consists of one or several hairy hollow stems, growing from one central stem, each with an umbrella-shaped flower cluster at the top. Plant smells like a carrot, it is the ancestor of the garden carrot. Appears as rosette in its first year.
Category:
1 Roots and Root Systems: Structure, Function, and Diversity Questions 1. What is the signicance of the root to shoot ratio in plants? 2. What are examples of roots that are used in human cuisine? Name at least ve. What do these roots generally have in common?
Category:
4. cwe031.fm.
Glycobiology vol. 11 no. 4 pp. 261274, 2001 © 2001 Oxford University Press 261 Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core ±1,3-linked fucose and xylose substitutions Iain B.H.
Category:
5. Common name.
Common name Scientific name Family maple Acer saccharum Aceraceae kiwi, Chinese Actinidia chinesis Actinidiaceae cashew Anacardium occidentale Anacardiaceae pawpaw Asimina triloba Anacardiaceae mango Mangifera indica L Anacardiaceae pistachio Pistacia vera L. Anacardiaceae dill Anethum
Category:
>P83218|PME_DAUCA Pectinesterase - Daucus carota (Carrot). QSSTVTPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIM FLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVG SDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSG
Category:
This Weeks Citation CIassiC~ ~ 1 Halperln W & Wethereil D F. Adventive embryony in tissue cultures of the wild carrot, Daucus carota. Amer. I. Bot. 51:274-83, 1964.
Category:
8. GiardiaDB.
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Category:
This area of the National Biological Information Infrastructure (NBII) conceptualizes, organizes, and displays a wide range of biological information from geographical and geospatial perspectives.
Category:
rer. hort. - genehmigte Dissertation von Dipl.-Ing. agr. Jochen Hemming geboren am 17.12.1969 in Seeheim-Jugenheim 2000 Referent: PD Dr. rer. hort. T. Rath Korreferent: Prof. Dr. agr. B. Hau Tag der Promotion: 28.
Category:
