+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
A Close-up View of the Bird's - Nest Weed Queen Anne's Lace (Daucus carota).
16717
A Close-up View of the Bird's - Nest Weed Queen Anne's Lace (Daucus carota).
http://www.microscopy-uk.org.uk/mag/artapr05/bjwildcarrot.html
During the summer months, the tall stalks of this elegant white wildflower can be seen gracing the landscape near roadsides, and in untended fields. Queen Anne s Lace originated in Eurasia, and was transported to North America in the seventeen and eighteen hundreds.
Crops > Carrot > Research
field guide daucus carota schizocarps bristly bracts underside wild carrot focal length cultivated variety
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
Spis publikacji prof. dr hab. Krystyna Tylkowska Oryginalne prace twórcze: Tylkowska K. 1984. Wystpowanie grzybów na nasionach fasoli reprodukowanych w ró|nych rejonach Polski. Biuletyn Instytutu Hodowli i Aklimatyzacji Ro[lin, 153: 185-202. Tylkowska K. 1984.
Category:
This Weeks Citation CIassiC~ ~ 1 Halperln W & Wethereil D F. Adventive embryony in tissue cultures of the wild carrot, Daucus carota. Amer. I. Bot. 51:274-83, 1964.
Category:
Genomic cartography of varicella-zoster virus: A complete genome-based analysis of strain variability with implications for attenuation and phenotypic differences.
Category:
Topic 5 Molecular mechanisms of regulation Content P5-4: Ion channels in the protoplasts of the mediterranean seagrass Posidonia oceanica. P5-5: Assembly of plant Shaker-like Kout channels requires two distinct sites of the channel ±-subunit. P5-6: How do plant K+ channels sense K+ ?
Category:
i] A GRICUL TURE 99 'rABLE II-(continued) PRINCIPAL CROPS CULTIVATED IN INDIA Botanical Name. English Name. Vernacular stNaime in Hindustani. --igaed Garden, C'ros. Saccharum officinarum . . Sugar-cane . Ukh or lkh. Zingiber officinale . . Ginger . Adrak or Sonth. Curcuma longa . . . Turmeric .
Category:
403 Effect of different active ingredients of fungicides on Alternaria spp. growth in vitro E. Survilien and E. Dambrauskien Lithuanian Institute of Horticulture, LT-54333 Babtai, Kaunas distr., Lithuania; e-mail: e.surviliene@lsdi.lt Abstract.
Category:
Daucus carota (carrots) are one of the more commonly used vegetables in the western world. A member of the parsley family (Umbelliferae) which includes caraway, celery, dill, and parsnips, the history of the carrot is somewhat obscure.
Category:
February 10, 2003 http://ag.arizona.edu/plpext/diseases/vegetables/carrot/carrot.
Category:
Alignment gi|4127741|emb|CAA07244.1| carrot chalcone synthase 1naringenin-chalcone synthase [Daucus carota]gi|12229621|sp|Q9ZS41|CHS1_DAUCA Chalcone synthase 1(Naringenin-chalcone synthase 1) (DcCHS1) Query: 17 HEVGLAQLPPAPPTTVAVIEGLATGTPRRVVNQSDAADRVAELFLDPGQRERIPRVY 73 +E AQ P T +A+ T TP V+QS AD
Category:
bstract. The ABA INSENSITIVE1 (ABI1) and ABI2 genes encode homologous type-2C protein phosphatases with redundant yet distinct functions in abscisic acid (ABA) responses.
Category:
