+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Protease Activity and Development in Daucus carota and Trifolium repens Hairy Roots in Culture Media Containing Different Nitro.
16753
Protease Activity and Development in Daucus carota and Trifolium repens Hairy Roots in Culture Media Containing Different Nitro.
http://faculty.tamu-commerce.edu/agoyal/journals/pmbp/v8n2/p11.html
Universidade Federal Rural do Rio de Janeiro, Departamento de Química and Departamento de Solos, Rodovia Rio-São Paulo km 47, Seropédica, RJ, CEP 23851-000, Brazil;
Crops > Carrot > Research
hairy roots daucus carota soluble sugar l trifolium nitrogen sources protease agrobacterium rhizogenes ammonium
Jan 1, 2006
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Carrot > Research
Efeito da radiação solar sobre o acúmulo de matéria seca e teores de nitrogênio, potássio e cálcio ... Effect of global solar radiation on dry matter accumulation and uptake of N ... - Augusto Tayoshi, João Alexandre Galon...
Category:
bstract The fungal plant pathogen Sclerotinia sclerotiorum is responsible for disease in a wide range of commercially important crops throughout the world. Sclerotinia disease, or cottony soft rot, in carrot (Daucus carota L.) crops, is generally a post-harvest problem during storage.
Category:
PUBLICATIONS Koukkari, W. L. and W. S. Hillman. 1966. Phytochrome levels assayed by in vivo spectrophotometry in modified underground stems and storage roots. Physiol. Plant. 19:1073-1078. Koukkari, W. L. and W. S. Hillman. 1967.
Category:
4. 150.pdf.
1 56 Chinese Science Bulletin Vol. 45 No. 2 January 2000 Cloning of lea cDNA fragment of carrot (Daucus carota L.) and analysis of its expression features QI Mei1,2 , CHEN Fan1 , HUANG Meijuan2 & WU Naihu1 1. Institute of Developmental Biology, Chinese Academy of Sciences, Beijing 100080, China; 2.
Category:
© 2006 Ruhlman et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.
Category:
Wild carrot (Daucus carota var. carota) cell suspensions (63 120 µm in diameter) were grown on a mineral salt medium containing different carbon sources in the presence (10 mM) and absence of myo-inositol.
Category:
you need to determine which nematodes are present in the soil before using this list to make management decisions.
Category:
FUNCTION: The primary product of this enzyme is 4,2',4',6'-tetrahydroxychalcone (also termed naringenin-chalcone or chalcone) which can under specific conditions spontaneously isomerize into naringenin.
Category:
Symposium on Dietary phytochemicals and human health Salamanca, April 18-20, 2002 Symposium Secretariat Laboratorio de Nutrición y Bromatología. Facultad de Farmacia. Campus Miguel de Unamuno . Universidad de Salamanca.
Category:
>d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi} attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
Category:
