+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Scientific Correspondence Using Cauliflower to Find Conserved...
16898
Scientific Correspondence Using Cauliflower to Find Conserved...
https://bioinformatics.cs.vt.edu/~easychair/ColinasEtAl_PlantPhys_2002.pdf
The level of homology suggests that comparison of these two species could reveal func- tional cis-regulatory elements. There is growing interest in comparing genome sequences to identify regulatory regions (Stojanovic et al., 1999).
Crops > Cauliflower > Research
cauliflower non-coding sequences regions start site region regulatory translation protein 1 genomic related genomes
Jan 1, 2003
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Cauliflower > Research
hi everybody, i am doing a project on the tissue culture of cauliflower, can anyone give me some suggestions or scientific websites for the best protocol?
Category:
>gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus peptidase (A3) NPNSIYIKGKLYFKGYKAYSLHCYVDTGASLCIASKKIIPEEYWENAKKPIEVKIANGSIITITKVCSNLFLKIAGKRFL IPTVYQQESGIDLILGNNFCKLYNPFIQYLDRIEFHKKNLEPVEIKKITKAILVGNEGFLESMKKISKTQQPYPFNITIN TIQLEEICSINPGDEEKLFNTIIIKIQLIEPLLEKVCSENP
Category:
The mechanism(s) behind RNA editing in higher plants is not yet understood. To gain further insight, the work reported in this thesis has improved the current mitochondrial in vitro RNA editing system (in mitochondria) and adapted it to another, convenient plant species, cauliflower.
Category:
Pilarczyk A., 1973. The morphological and histological structure of tumours in the cauliflower disease (papilloma) of eels. Acta Ichthyol. Piscat. 3 (1): 91106. Tumours appearing on eels with the "cauliflower disease" are morphologically different from each other.
Category:
5. Cauliflower.
CAULIFLOWER (CAL ) is a flower meristem identity gene and is closely related to APETALA1 (AP1 ), and these two gene products share 76% identical and 88% similar amino acid sequences.
Category:
Proteins frequently possess post-translational modifications, thus resulting in an increase in protein mass, which often cannot be predicted from the gene sequence. Common post-translational modifications are phosphorylation, sulfation, acetylation, and glycosylation. The combination of capillary
Category:
definition of the term 'cauliflower': compact head of white undeveloped flowers
Category:
Skipped content of type multipart/alternative-------------- next part -------------- A non-text attachment was scrubbed... Name: not available Type: image/gif Size: 10886 bytes Desc: not available Url : http://lists.hampshire.edu/pipermail/mensproject/attachments/20060508/7587bf53/attachment.
Category:
Cooperative Extension Service CTAHR Fact Sheet Home Garden Vegetable no. 7* January 1997 *Replaces Instant Information/Home Garden Vegetable Series no. 7. Issued in furtherance of Cooperative Extension work, Acts of May 8 and June 30, 1914, in cooperation with the U.S. Department of Agriculture.
Category:
Verticillium wilt, a damaging disease of cauliflower, was successfully managed in a multiple-year field study by incorporating broccoli residues into infested soil.
Category:
