+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Nres 700.
17738
Nres 700.
http://www.uwsp.edu/natres/nres715/Enrolled%20Students/nres_715_ii_section_c.htm
Spices had been used by people for more than 5,000 years. In addition to flavoring food, spices also provide vital medicines and beauty aids. While herbs tend to be leaves that are aromatic, spices are aromatic plant organs such as stems, fruits, seeds, roots and bark.
Crops > Chili pepper > Research
black mustard chili pepper saffron family alternate route zingiber officinale mint parsley myristica fragrans volatile oils
Jan 1, 2005
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Chili pepper > Research
This page is about chilli peppers, the fruit of the Capsicum family of plants. It is these fruit which provide the 'heat' to food from across the world.
Category:
University of Connecticut Newsletter of the Asian American Studies Institute No. 7, Fall 2001 Directors Desk.......................................2 Dot.Com or Dot.Comrade......................3 Asian American Heritage......................4-5 Critical Issues Series...............................
Category:
Agriculture, Ecosystems and Environment 89 (2002) 213228 Logistic modelling to derive agricultural land use determinants: a case study from southeastern Nigeria A. Gobin, P. Campling, J.
Category:
The hottest bite in the plant-world, this annual plant originates from Central America where many varieties were developed over hundreds of years by indigenous people. When discovered by the Spanish and Portuguese, they were quickly introduced into their cuisine.
Category:
Plant Breeders Rights QP Workshop 2004 Resource Kit CONTENTS CULTIVAUST................................................................................................................................... 3 UPOV TG LIST................................................................................
Category:
García-Hernández, J.L., E. Troyo-Diéguez, B. Murillo-Amador, A. Flores-Hernández, A. González-Michel, 2001. Efecto de algunos insecticidas y un promotor de crecimiento sobre variables fisiológicas y el rendimiento de tomate (Lycopersicon esculentum L.) cv.
Category:
>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Category:
8. Haemorrhoids and transient receptor potential vanilloid 1 -- di Mola et al. 55 (11): 1665 -- Gut.
Haemorrhoids are extremely common, and approximately 10 million people are affected by haemorrhoidal disease in the USA.1 Many causes have been proposed to explain the pathogenesis of symptomatic haemorrhoids.
Category:
"If you've got seven different kinds of peppers, if you're using them fresh and you're using them dried, you've got some interesting food," says archaeobotanist Linda Perry of the Smithsonian National Museum of Natural History in Washington, D.C.
Category:
C.T 2601. GPO Box 574 Canberra A.C.T. 2601 Telephone (02) 6247 9420 Fax (02) 6247 9582 Email edoact@edo.org.au www.edo.org.auwww.edo.org.auwww.edo.org.auwww.edo.org.
Category:
