+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
CAPSICUM - [Alternative Medicine].
17880
CAPSICUM - [Alternative Medicine].
http://www.lumc.edu/health/kbase/htm/mdx-/ame0/034/mdx-ame0034.htm
Capsicum is an herbal medicine used on the skin to treat pain from arthritis and muscle aches, and help healing. Capsicum is also used as a gargle for sore throats and taken by mouth for stomach and gas pain. Other names for Capsicum include: Cayenne
Crops > Chili pepper > Research
capsicum herbal medicines stomach pain over-the-counter blood vessel disease post-herpetic neuralgia long-term course medicine irritable bowel
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Crops > Chili pepper > Research
1. New Page.
Pepper is the name of the pungent spice from the ground fruits and seeds of Piper nigrum, an Old World, tropical vine. When Europeans discovered the New World they were expecting the spice islands of SE Asia, and so called them the Indies and their native inhabitants, Indians.
Category:
Todays Bread Turkish pita with roasted capsicum, white bean and babagnosh dips 3.5 Salad of Roasted Asparagus goats milk feta, crispy prosciutto and smoked capsicum vinaigrette 8.9 Potato Gnocchi with slow roasted tomato, basil and chilli ragu, with shaved pecorino cheese 9.
Category:
Distinction of water-soluble constituents between natural and cultured Cordyceps by capillary electrophoresis.: An article from: Phytomedicine: International ... Journal of Phytotherapy & Phytopharmacology by: S.P. Li, Z.H. Song, T.T.X. Dong, Z.N. Ji, C.K. Lo, S.Q. Zhu, K.W.K.
Category:
DESCRIPTION: These are tender annuals or perennials from South America. They have straight, woody stems and single, star-shaped, white flowers in the axils of the leaves. The flowers are followed by juiceless berries or pods, which vary in shape and size.
Category:
Note to users. If you're seeing this message, it means that your browser cannot find this page's style/presentation instructions -- or possibly that you are using a browser that does not support current Web standards.
Category:
C.T 2601. GPO Box 574 Canberra A.C.T. 2601 Telephone (02) 6247 9420 Fax (02) 6247 9582 Email edoact@edo.org.au www.edo.org.auwww.edo.org.auwww.edo.org.auwww.edo.org.
Category:
7. Contents.
In Vitro Metabolism Effect on Genotoxicity and Antigenotoxicity of Agaricus blazei Organics and Aqueous Extracts by the Comet Assay.....
Category:
>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Category:
9. Bahk,YY.
The U-box motif is a conserved domain found in the diverse isoforms of E3 Ub ligase in eukaryotes. From water-stressed hot pepper plants, we isolated CaPUB1 (Capsicum annuum putative U-box protein 1) that encodes a protein containing a single U-box motif in its N-terminal region.
Category:
10. 1525-1580.
delzii,588 subsp. monococca, 588 var. monococca, 588 lindheimeri, 589 monococca, 588 ostryifolia, 588 phleoides, 588 radians, 589 rhomboidea, 589 virginica, 589 var.
Category:
