Browse by Tag: arabidopsis

ADD A LISTING

+ Main Category

Crops: 6293

Biology: 166

Research: 755

Business: 40

Home Gardening: 99

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

+ Top 10

Pomology: Fruit Cultivation and Production

TropHort: Biology, Agriculture, Horticulture and Forestry

Producing Vegetable Crops 5th Edition by John M. Swiader.

Microsoft Word - Bell pepper lesson.doc.

Texas A&M University System Research & Extension Center at Stephenville - Horticulture.

Broccoli.

Asparagus - Wikipedia, the free encyclopedia

Veg&Fruit2007:Layout 1.

Alleviating malnutrition through agriculture in Bangladesh.

JCE 2006 (83) 1049 [Jul] Enantioselective Reduction by Crude Plant Parts: Reduction of Benzofuran-2-yl Methyl Ketone with ...

+ Directory Statistics

Links: 6602
Categories: 68
Registered Users: 78
Mailing List Subscribers: 14

+ Pagerank Statistics

PR 7

2 site(s)

PR 6

41 site(s)

PR 5

197 site(s)

PR 4

628 site(s)

PR 3

898 site(s)

PR 2

500 site(s)

PR 1

192 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.

Web Links [Tag : arabidopsis]

1. Carina Barth.

The small antioxidant vitamin C is important for human nutrition, because most animals, including humans, cannot synthesize AA. Important functions of the body, such as collagen biosynthesis, immune responses, pulmonary function, and iron absorption all require vitamin C.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

2. CEA Direction des sciences du vivant - iRTSV : Benoît Van der Rest.

Le métabolisme de la glycérophosphocholine chez les végétaux : caractérisation d'une glycérophosphodiester phosphodiestérase. Glycerophosphocholine metabolism in plant: Characterization of a new glycerophosphodiester phosphodiesterase.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

3. PGN - Sequence Details.

00: gb|AAM81202.1| calmodulin 1 [Medicago truncatula] gb|AAD53313.1| calmodulin 7 [Arabidopsis thaliana] emb|CAH57707.1| calmodulin [Quercus petraea] gb|AAM66013.1| calmodulin 7 [Arabidopsis thaliana] emb|CAA43143.1| Calmodulin [Malus x domestica] emb|CAB83153.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

4. Hh-i-3.

--- AAGAAGEN A.adeninivorans GAA gene for glucoamylase. --- (2769 bases) |SCO: 1.15|POS:2253-2378|MIS: 0|WOB: 1| |AGC|GAA|GU|.. 80 nuc ..|AC|C|ACA|CUCCUUCUUCUGGCCACA|UGU|CUGAAGA|GUU| --- AB005230 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone: MAC12, --- (74613 bases) |SCO: 1.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

5. CCGB BLAST Report Display.

minmatch = Minimum length of matching word required to nucleate SWAT comparison. minscore = Minimum alignment score minlength = Minimum size in basepairs of sequences of sequences selected for this assembly. For more information see: http://www.phrap.org/phrap.docs/phrap.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

6. Accession Numbers for CRKs Listed in Alignment Figure.

Accession Numbers for CRKs Listed in Alignment Figure (from Calcium-Dependent Protein Kinases and Their Relatives, Advances in Botanical Research, Volume 32, M. Kreis and J. C. Walker (eds.) Species CRK name Accession Number cDNA Genomic Arabidopsis thaliana (mouse-eared

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

7. ESTree: blast output page.

Query sequence: S39K5 (611 letters) Database: ./db/nr 2,304,535 sequences; 784,226,776 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM81202.1| calmodulin 1 [Medicago truncatula] >gi|5825598|gb...

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

8. View entire record back to category listing new search scientific...

Investigation on dissipation of alachlor in cotton plant, soil and water and its bioaccumulation in fish shows that the green leafy vegetable samples like Coriandrum sativum and edible amaranth did not show any toxic symptoms of alachlor residues.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

9. !!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383...

!!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383 February 19, 1999 15:06 REFORMAT of: seq.seq check: 4199 from: 1 to: 383 February 19, 1999 15:04 (No documentation) TO: SwissProt:* Sequences: 71,248 Symbols: 25,831,459 Word Size: 2 Databases searched: SWISS-PROT, Release 35.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

10. Katherine DeGuire.

THE EFFECTS OF NMCP MUTATIONS ON NUCLEAR SIZE IN ARABIDOPSIS THALIANA. Katherine DeGuire1, Travis Dittmer1, Eric Richards1, Biology Department, Washington University, St Louis, MO1.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

11. Homology models For the WD DOMAIN.

Domain architecture information on representative(s) of the 44 S60 cluster(s) of the current cluster.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

12. Texas Tech University :: Department of Biological Sciences.

Drought conditions affect an estimated 25% of crops with a corresponding decrease in productivity estimated worldwide to be worth US$10 billion/yr. Reclamation of arable land of marginal quality will result in crops that increasingly experience salt stress.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

13. XcisClique: View cis-Element.

CharacteristicTypecisIDDPBFCOREDCDC3Annotation"A novel class of bZIP transcription factors, DPBF-1 and 2 (Dc3 promoter-binding factor-1 and 2) binding core sequence; Found in the carrot (D.c.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

14. Selected Genes.

factormedian_fitted_datamedian_fitted_datagene annotationgene annotation condition1condition0(CONTROL)condition1functional categorydescription VBVHG06?

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

15. a2m2html output for file tmp.a2m.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

16. Seq_Name Matching_Seq Putative_Function SSR_Num SSR_Type SSR SSR_size...

{Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

17. >chloroplast

| chloroplast.|-!- subcellular location: chloroplast. MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAIM >peroxisome Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

18. BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L....

BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

19. >K0_1 No match I:0 Q:0 S:0 Full:0...

>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

20. Internationale biometrische gesellschaft société internationale de...

, Konto-Nummer: 847 58 - 672, BLZ: 545 100 67 Rundschreiben 3 / 2000 November 2000 Internationale Biometrische Gesellschaft - Deutsche Region: Rundschreiben 3/2000 2 Inhalt - Grußworte 3 - Bericht vom IBS-Council-Meeting 6.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: 1 2 3 4 5 6 [Next >]