Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6293
Biology: 166

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6602
Categories: 68
Registered Users: 78
Mailing List Subscribers: 14

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
41 site(s)
PR 5
197 site(s)
PR 4
628 site(s)
PR 3
898 site(s)
PR 2
500 site(s)
PR 1
192 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : arabidopsis]


Sort By :
The small antioxidant vitamin C is important for human nutrition, because most animals, including humans, cannot synthesize AA. Important functions of the body, such as collagen biosynthesis, immune responses, pulmonary function, and iron absorption all require vitamin C.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Le métabolisme de la glycérophosphocholine chez les végétaux : caractérisation d'une glycérophosphodiester phosphodiestérase. Glycerophosphocholine metabolism in plant: Characterization of a new glycerophosphodiester phosphodiesterase.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

00: gb|AAM81202.1| calmodulin 1 [Medicago truncatula] gb|AAD53313.1| calmodulin 7 [Arabidopsis thaliana] emb|CAH57707.1| calmodulin [Quercus petraea] gb|AAM66013.1| calmodulin 7 [Arabidopsis thaliana] emb|CAA43143.1| Calmodulin [Malus x domestica] emb|CAB83153.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

--- AAGAAGEN A.adeninivorans GAA gene for glucoamylase. --- (2769 bases) |SCO: 1.15|POS:2253-2378|MIS: 0|WOB: 1| |AGC|GAA|GU|.. 80 nuc ..|AC|C|ACA|CUCCUUCUUCUGGCCACA|UGU|CUGAAGA|GUU| --- AB005230 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone: MAC12, --- (74613 bases) |SCO: 1.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

minmatch = Minimum length of matching word required to nucleate SWAT comparison. minscore = Minimum alignment score minlength = Minimum size in basepairs of sequences of sequences selected for this assembly. For more information see: http://www.phrap.org/phrap.docs/phrap.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Accession Numbers for CRKs Listed in Alignment Figure (from Calcium-Dependent Protein Kinases and Their Relatives, Advances in Botanical Research, Volume 32, M. Kreis and J. C. Walker (eds.) Species CRK name Accession Number cDNA Genomic Arabidopsis thaliana (mouse-eared
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Query sequence: S39K5 (611 letters) Database: ./db/nr 2,304,535 sequences; 784,226,776 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM81202.1| calmodulin 1 [Medicago truncatula] >gi|5825598|gb...
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Investigation on dissipation of alachlor in cotton plant, soil and water and its bioaccumulation in fish shows that the green leafy vegetable samples like Coriandrum sativum and edible amaranth did not show any toxic symptoms of alachlor residues.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

!!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383 February 19, 1999 15:06 REFORMAT of: seq.seq check: 4199 from: 1 to: 383 February 19, 1999 15:04 (No documentation) TO: SwissProt:* Sequences: 71,248 Symbols: 25,831,459 Word Size: 2 Databases searched: SWISS-PROT, Release 35.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

THE EFFECTS OF NMCP MUTATIONS ON NUCLEAR SIZE IN ARABIDOPSIS THALIANA. Katherine DeGuire1, Travis Dittmer1, Eric Richards1, Biology Department, Washington University, St Louis, MO1.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Domain architecture information on representative(s) of the 44 S60 cluster(s) of the current cluster.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Drought conditions affect an estimated 25% of crops with a corresponding decrease in productivity estimated worldwide to be worth US$10 billion/yr. Reclamation of arable land of marginal quality will result in crops that increasingly experience salt stress.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

CharacteristicTypecisIDDPBFCOREDCDC3Annotation"A novel class of bZIP transcription factors, DPBF-1 and 2 (Dc3 promoter-binding factor-1 and 2) binding core sequence; Found in the carrot (D.c.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

factormedian_fitted_datamedian_fitted_datagene annotationgene annotation condition1condition0(CONTROL)condition1functional categorydescription VBVHG06?
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

(c) 1992-2000 Regents of the University of California, Santa Cruz Sequence Alignment and Modeling Software System http://www.cse.ucsc.edu/research/compbio/sam.html
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

{Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

| chloroplast.|-!- subcellular location: chloroplast. MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAIM >peroxisome Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

, Konto-Nummer: 847 58 - 672, BLZ: 545 100 67 Rundschreiben 3 / 2000 November 2000 Internationale Biometrische Gesellschaft - Deutsche Region: Rundschreiben 3/2000 2 Inhalt - Grußworte 3 - Bericht vom IBS-Council-Meeting 6.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: 1 2 3 4 5 6 [Next >]



Valid XHTML 1.0 Transitional   Valid CSS