+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6596
Categories: 68
Registered Users: 85
Mailing List Subscribers: 19
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : arabidopsis]
172 22 AAAGCTCTTCATGGGAGCAA 59.955 20 228 4 231 GCGGGACACAGAACTTCTTTAC 60.172 22 GGAGCAACACCCTGAATGAT 59.934 20 215 4 218 GCGGGACACAGAACTTCTTTAC 60.172 22 ACATTTGCAGCCATTTCCTC 60.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: >K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: ) Jo J-Y, Choi E-Y, Choi D, Lee K-W pepper (Capsicum annuum L.), immature zygotic embryo, somatic embryogenesis, ethylene inhibitor, scanning electron microscopy 127-135 Microstructure of Perigynium and Achene Surfaces of Carex sect.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: This page was last modified Feb. 14, 2003. Plant P450s that have appeared since the 1993 P450 nomenclature update. Part D of the bibilographic P450 documents. These files were broken into five parts to reduce the download time for each part.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: AC: RSP00001//OS: tomato (Lycopersicon esculentum) /GENE: pds/RE: Pds/Le element /BF: unknown nuclear factor 2. AC: RSP00002//OS: Brassica napus /GENE: Oleosin/RE: ABRE-3 /BF: B.napus embryo protein factor 3.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 86. untitled.
Comparative Analysis of Expressed Genes from Cacao Meristems Infected by Moniliophthora perniciosa ABELMON S. GESTEIRA1 , FABIENNE MICHELI1,2 *, NICOLAS CARELS3, ALINE C. DA SILVA1!, KARINA P. GRAMACHO4, IVAN SCHUSTER5, JOCI N. MACEÆ DO1§, GONC¸ ALO A. G. PEREIRA6 and JU´ LIO C. M.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: TRANSCRIPT PROFILING AS A METHOD TO STUDY FRUIT MATURATION, TREE- RIPENING, AND THE ROLE OF TREE FACTOR IN GALA AND FUJI APPLES Shu-fei Lin, Doctor of Philosophy, 2005 Dissertation directed by: Professor Christopher S.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: FASTA searches a protein or DNA sequence data bank version 3.3t07 Sept. 19, 2000 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 At1g12220.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 89. tecnico.
Departamento: Ecología Funcional Laboratorio: Genética Molecular, Desarrollo y Evolución de Plantas Responsable: Dra. Elena Alvarez-Buylla
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 90.
...
TBLASTN 2.2.4 [Aug-26-2002]Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Reviews: Google PR: Concept note: brassica genome sequencing written by Ian Bancroft and Yong Pyo Lim on behalf of the Multinational Brassica Genome Project steering group
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Inputs to the Active Indole-3-Acetic Acid Pool: De Novo Synthesis, Conjugate Hydrolysis, and Indole-3-Butyric Acid -Oxidation Bonnie Bartel,* Sherry LeClere, Mo´nica Magidin, and Bethany K.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: AtCYS1 from Arabidopsis thaliana encodes a protein of 102 amino acids that contains the conserved motif of cysteine protease inhibitors belonging to the cystatin superfamily (Gln- Val-Val-Ala-Gly). Recombinant A.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: RYUGO, K., SACHS, R. M. In vitro and in vivo studies of Alar (1, 1-dimethylaminosuccianmic acid, B-995) and related substances. J. Amer. Soc. Hort. Sci., 94:529-533, 1969. (#18-1029) SZTEIN, A. E.; COHEN, J. D.; SLOVIN, J. P. & COOKE, T. J. Auxin metabolism in representative land plants. Amer.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 95. References.
Aist, J. R., and Williams, P. H. (1971). The cytology and kinetics of cabbage root hair penetration by Plasmodiophora brassicae. Can. J. Bot. 49, 2023-2034. Baluska, F., Bacigalova, K., Oud, J. L., Hauskrecht, M., and Kubica, S. (1995).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: A nnu. Rev. Genomics Hum. Genet. 2004. 5:44377 doi: 10.1146/annurev.genom.5.061903.180017 Copyright c 2004 by Annual Reviews. All rights reserved First published online as a Review in Advance on June 1, 2004 PLANT GENOMICS: The Third Wave Justin O. Borevitz1,2 and Joseph R.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: A nnu. Rev. Genomics Hum. Genet. 2004. 5:44377 doi: 10.1146/annurev.genom.5.061903.180017 Copyright c 2004 by Annual Reviews. All rights reserved First published online as a Review in Advance on June 1, 2004 PLANT GENOMICS: The Third Wave Justin O. Borevitz1,2 and Joseph R.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: A nnu. Rev. Genomics Hum. Genet. 2004. 5:44377 doi: 10.1146/annurev.genom.5.061903.180017 Copyright c 2004 by Annual Reviews. All rights reserved First published online as a Review in Advance on June 1, 2004 PLANT GENOMICS: The Third Wave Justin O. Borevitz1,2 and Joseph R.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: ) Jo J-Y, Choi E-Y, Choi D, Lee K-W pepper (Capsicum annuum L.), immature zygotic embryo, somatic embryogenesis, ethylene inhibitor, scanning electron microscopy 127-135 Microstructure of Perigynium and Achene Surfaces of Carex sect.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: LOCUS ATCOR66M 513 bp mRNA PLN 02-MAR-1992 DEFINITION A.thaliana cor6.6 mRNA. ACCESSION X55053 VERSION X55053.1 GI:16229 KEYWORDS antifreeze protein homology; cold-regulated gene; cor6.6 gene; KIN1 homology. SOURCE thale cress.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
