+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : cress]
Rutgers researchers have found that the curry spice turmeric holds real potential for the treatment and prevention of prostate cancer, particularly when combined with certain vegetables.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: The small antioxidant vitamin C is important for human nutrition, because most animals, including humans, cannot synthesize AA. Important functions of the body, such as collagen biosynthesis, immune responses, pulmonary function, and iron absorption all require vitamin C.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: To promote the growth and development of plant biology, to encourage and publish research in plant biology, and to promote the interests and growth of plant scientists in general. ; To promote the growth and development of plant biology, to encourage and publish research in plant biology, and to
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 4. Slide 1.
Cancer Vegetables containing indole-3 carbinol: Bitter cress Cabbage Kale Bok Choy Cauliflower Radishes Broccoli Collard Turnip Watercress Horseradish Brussels sprouts Indole-3 carbinol can be deactivated by heat. Additional readings: Dwivedy, I.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: And new research suggests it might help protect against -- and even treat -- prostate cancer, especially when combined with a substance found in cauliflower, cabbage and other kinds of vegetables.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Domain architecture information on representative(s) of the 44 S60 cluster(s) of the current cluster.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: bstract Desiccation is the main environmental strain faced by plants and efforts to improve crop plants have concentrated largely on improving tolerance to this stress (Paleg 1981, Ramanjulu 2002).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 8. >chloroplast
| chloroplast.|-!- subcellular location: chloroplast. MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAIM >peroxisome
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: >K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: bpg000270global_homology 3 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.- bpg000275global_homology 2 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 11. Humboldt state.
HUMBOLDT STATE UNIVERSITY HERBARIUM MISCELLANEOUS PUBLICATION NO. 2 (18th Edition) A CHECKLIST OF THE VASCULAR PLANTS OF NORTHWESTERN CALIFORNIA BY James P. Smith, Jr. and John O. Sawyer, Jr.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Rutgers researchers have found that the curry spice turmeric holds real potential for the treatment and prevention of prostate cancer, particularly when combined with certain vegetables.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: 13. Curry and cauliflower could halt prostate cancer - Printer Friendly Page - Cancer - Bioinfo Online.
Rutgers researchers have found that the curry spice turmeric holds real potential for the treatment and prevention of prostate cancer, particularly when combined with certain vegetables.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Rutgers researchers have found that the curry spice turmeric holds real potential for the treatment and prevention of prostate cancer, particularly when combined with certain vegetables. The scientists tested turmeric, also known as curcumin, along w
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Rutgers researchers have found that the curry spice turmeric holds real potential for the treatment and prevention of prostate cancer, particularly when combined with certain vegetables.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Supplemental Table II â Top 200 ESTs LEAVES TC Leaf P(leaf) Total 32789 32789 Singleton 3777 3777 Counted 29012 29012 1 TC35585: chlorophyll a/b binding protein {Medicago sativa} 464 15.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 17. >chloroplast
| chloroplast.|-!- subcellular location: chloroplast. MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAIM >peroxisome
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 
Reviews: Google PR: 986 20 ACCCGAGATTGTTGGTTGAG 59.966 20 217 15 231 AGCTCAGTCCTCCACTTCCA 59.986 20 AATCGTTTGTAGCTGTCGGG 60.132 20 240 15 254 GGATTCCCAAACTCCGAAAT 60.131 20 ACCCGAGATTGTTGGTTGAG 59.966 20 140 92 231 >TA17352_4081 1 p1 (A)10 10 518 527 GGGCTTTTTGTGTAAAGGGTT 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: API61AA451580AA451580 nbspsimilar to GP|4038717|dbj|BAA35175.1||AB020956 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit {Triticum turgidum subsp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 257 species of vascular plants recorded from Burke Park as of 18 March 2005 Agavaceae Yucca glauca Nutt. Yucca Amaranthaceae Amaranthus californicus (Moq.)
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
