Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
176 site(s)
PR 4
611 site(s)
PR 3
861 site(s)
PR 2
522 site(s)
PR 1
199 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : daucus]


Sort By :
381. News.
Multiplication and Preliminary Characterization of West and Central African Pearl Millet Landraces BIG Haussmann1 *, A Boubacar2 , SS Boureima2 and Y Vigouroux3 [1. International Crops Research Insitute for the Semi-Arid Tropics (ICRISAT), BP 12404, Niamey, Niger; 2.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

A.B. Dongmo, A. Kamanyi, M.S. Anchang, B. Chungag-Anye Nkeh, D. Njamen, T.B. Nguelefack, T. Nole, H. Wagner, Anti-inflammatory and analgesic properties of the stem bark extracts of Erythrophleum suaveolens (Caesalpiniaceae), Guillemin & Perrottet, Journal of Ethnopharmacology 77 (2-3) (2001) pp.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

APIACEAE (formerly the Umbelliferae) John Navazio Organic Seed Alliance Apiaceae family 250 Genera 2800 Species Relatively little research of cultivated spp. Cultivated spp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Proven ability to plan, organize and manage projects. Skilled in presenting information. Strong independent researcher and trouble shooter. Excellent collaborator, supervisor and mentor.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Chemistry 338 Spring, 2005 Schedule Day Date Rept. Expt. Title of Experiment T-W 1/18-1/19 Check-in Safety R-M 1/20-1/24 DS 29.4 Library-Laboratory Connection T-W 1/25-1/26 DS 13.2 Exer. P & Mass Spec & Combined Spectroscopy R-M 1/27-1/31 DS 12.2A Nitration of Methyl
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

O estudo mostrou que a desidrata¸cÜao osm´otica utilizando solu¸cÜao com 35% de a¸c´ucar e 5% de sal, ao nal de 105 minutos, apresentou maior perda de ´agua e menor ganho de s´olidos.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

ISSN 0176-1617 Founded: 1909 Founded by: Ludwig Jost, Friedrich Oltmanns, Hermann Graf zu Solms-Laubach Language: English 2007: Volume 164 (12) Size: 210 mm x 280 mm Printed on acid-free paper Abbreviated title: J. Plant Physiol.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

96 Table IV - Seeds and pollen 1978 By Susan Colledge and James Greig Sample A87b 87 87g A114 B29 Name Habitat Pteridium aquilinum L. - - - - Ranunculus cf. acris L. - R.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The concept of thermal processing of foods is commonly used despite its adverse effect on nutritional and organoleptic qualities. Nowadays, consumer preferences move towards healthier and more fresh like foods.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

1| phytoene synthase 1 [Prunus armeniaca] FKDMIEGMRMDLRKSIYQNFDELYLYCYYVAGTVGLMSVPVMGISPESQATTESVYNAALALGIANQLTN ILRDVGEDARRGRIYLPQDELAQAGLSDSDIYAGKVTDKWRSFMKNQIKRARMFFDEAEKGVTELSEASR WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLALPIAYTKSLIRPSRTSSYSTRAQKTDSLTSK V
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Sept. 1974-March 1977, MS Chairman - Effects of storage conditions, growth regulators, and maturity on ATP content and seedling vigor of vegetable seeds.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Other ingredients: Fructose, silica, natural vanilla and a whole food complex - Broccoli (Brassica Oleracea floret extract), carrot (Daucus Carota root), spirulina, chlorella, apple, Black Currant.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Queen Anne's Lace was introduced to North America hundreds of years ago by European settlers. Queen Anne's Lace is easy to identify and is often seen in abundance along the sides of roads or in meadows. The plant grows approximately 1 m (2-4 ft) tall.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Proc. Fla. State Hort. Soc. 118: 2005. 423 Proc. Fla. State Hort. Soc. 118:423-428. 2005. A REFEREED PAPER DESIGN OF PERFORATION-MEDIATED MODIFIED ATMOSPHERE PACKAGING FOR SHREDDED CARROTS: MATHEMATICAL MODELLING AND EXPERIMENTAL VALIDATION JULIO MONTANEZ,1 FERNANDA A.R.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Hassett, S-J. & Bradley, P.M. Isozyme patterns seen in two species of lichens (i.e. Parmelia sulcata Tayl. and P. caperata (L.) Ach.). Abstracts of the 1998 Congress on In Vitro Biology (Las Vegas, NV., May 30, 1998). In Vitro, Cellular & Developmental Biology, 34, (3) part II 73a.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

This section aims to provide a maximum of database cross-references for each protein. This includes the databases cited in the DR lines of the Swiss-Prot entries but also other data sources and internal pointers. Here you get more details about the different databases that we point to.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Ph.D., Biology, University of California, 1983 jung.choi@biology.gatech.edu Phone: (404) 894-8423 Fax: (404) 894-0519 Office: (Cherry Emerson) 213/210
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Yates EA, Valdor J-F, Haslam SM, Morris HR, Dell A, Mackie W, Knox JP (1996) Characterization of carbohydrate structural features recognized by anti-arabinogalactan-protein monoclonal antibodies.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

English name Englischer Name German name Deutscher Name Scientific name Wissenschaftlicher Name alfalfa Luzerne Medicago sativa L. anise Anis Pimpinella anisum L. apple Apfel Malus sylvestris Mill. ssp. mitis (W.) M. var. domestica (Bor.) Ma. apricot Aprikose Prunus armeniaca L.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Uptake of organic contaminants by crops grown in sewage sludge-amended soil Frank Laturnus The Swedish Institute for Climate Science and Policy Research, ITUF, Linköpings universitet, 601 74 Norrköping, Sweden (email frank.laturnus@ituf.liu.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: [<< First] [< Previous] 15 16 17 18 19 20 21 22 23 24 [Next >] [Last >>]



Valid XHTML 1.0 Transitional   Valid CSS