+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6600
Categories: 68
Registered Users: 108
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : dna-binding]
3.6.1.4 scorpion toxin {(Androctonus australius hector), toxin II} vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp grch >d1cex__ 3.14.7.1.1 Cutinase {fungus (Fusarium solani, subsp.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: minmatch = Minimum length of matching word required to nucleate SWAT comparison. minscore = Minimum alignment score minlength = Minimum size in basepairs of sequences of sequences selected for this assembly. For more information see: http://www.phrap.org/phrap.docs/phrap.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: array_element_name array_element_type organism is_control locus description is_ambiguous chromosome start stop 18001_at oligonucleotide Arabidopsis thaliana no AT1G01040 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Probe Set AGI Data Source Criterion for Match TIGR Description 13254_at AT4G17190 TIGR ATH1.seq 100 percent over >= 50 bp, unique. farnesyl pyrophosphate synthetase 2 (FPS2) [farnesyl diphosphate synthase 2] / identical to GB:46350; supported by cDNA: gi_1146162_gb_L46349.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: -- dump date 20030806 -- class Genbank::CDS -- table CDS_note -- id note 15223276 contains Pfam PF02365: No apical meristem (NAM) domain similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana] 15223284 similar to DNA-binding proteins from [Arabidopsis thaliana] RAV1
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Centre RAS (Ufa), Russia Lev Kisselev, Engelhardt Institute of Molecular Biology, Moscow, Russia Boris Kovalerchuk, Central Washington University (Ellensburg), USA Luciano Milanesi, ITBA, Milan, Italy John Reinitz, The University at Stony Brook, N.Y.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: The formin family of proteins has been implicated in signaling pathways of cellular morphogenesis in both animals and fungi; in the latter case, at least, they participate in communication between the actin cytoskeleton and the cell surface.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Probe Set AGI Data Source Criterion for Match TIGR Description 13254_at AT4G17190 TIGR ATH1.seq 100 percent over >= 50 bp, unique. farnesyl pyrophosphate synthetase 2 (FPS2) [farnesyl diphosphate synthase 2] / identical to GB:46350; supported by cDNA: gi_1146162_gb_L46349.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: array_element_name array_element_type organism is_control locus description is_ambiguous chromosome start stop 18001_at oligonucleotide Arabidopsis thaliana no AT1G01040 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Xanthomonas campestris pv. phaseoli OhrR belongs to a major family of multiple-cysteine-containing bacterial organic hydroperoxide sensors and transcription repressors.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Control of Temperature-Responsive Synthesis of the Phytotoxin Coronatine in Pseudomonas syringae by the Unconventional Two-Component System CorRPS Angela V. Smirnova, Ling Wang, Bettina Rohde, Ina Budde, Helge Weingart, and Matthias S.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
