+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6596
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : domain]
Generated from scop database 1.69 with scopm 1.101 on Fri Jul 29 15:51:10 2005 Copyright © 1994-2005 The scop authors / scop@mrc-lmb.cam.ac.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: Structural Classification of Proteins Protein: Ferredoxin reductase (flavodoxin reductase) N-terminal domain from Paprika ( Capsicum annuum Lineage: Root: scop Class: All beta proteins [48724] Fold: Reductase/isomerase/elongation factor common domain [50412] barrel, closed n=6, S=10
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: G. Vancanneyt, U. Sonnewald, R. Hofgen and L. Willmitzer Institut fur Genbiologische Forschung GmbH, Ihnestrasse 63, D-1000 Berlin 33, Federal Republic of Germany Patatin, the major glycoprotein in potato tubers, is encoded by a multigene family.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: The River Crossing Game David Goering and Dan Canada 3 The River Crossing Game is easy to describe: Each of two players distributes 11 boats (chips) at docks numbered from 2 to 12. More than one boat may be placed at a dock.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 5. CGF: News.
Drive down Highway 1 as it snakes along the San Mateo County coastline and you can't miss it: rows of greenhouses, hillsides dotted with grazing cows and acres of Brussels sprouts and fava beans stretching to the horizon line.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: In order to clone the gene encoding a type I DNA topoisomerase from Leishmania donovani, a PCR-amplified DNA fragment obtained with degenerate oligodeoxyribonucleotides was used to screen a genomic library from this parasite.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 3.6.1.4 scorpion toxin {(Androctonus australius hector), toxin II} vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp grch >d1cex__ 3.14.7.1.1 Cutinase {fungus (Fusarium solani, subsp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: The present study was undertaken to identify receptors for pierisin-1. The cross-linking and cloning experiments suggested that the proteins on cell membrane had no binding ability to pierisin-1.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >d1cbn__ 7.11.1.1.1 Crambin [abyssinian cabbage (Crambe abyssinica)] TTCCPSIVARSNFNVCRLPGTPEALCATYTGCIIIPGATCPGDYAN >d2erl__ 1.10.1.1.1 ER-1 [Euplotes raikovi] DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV >d8rxna_ 7.34.3.1.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: LOCUS AF043110 756 bp mRNA PLN 26-AUG-1998 DEFINITION Daucus carota phosphatidylinositol 4-kinase alpha (DcPI4Kalpha) mRNA, partial cds. ACCESSION AF043110 NID g3452272 VERSION AF043110.1 GI:3452272 KEYWORDS
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Cluster 1354 with 4 members. d1h80a__2. b.80.1.8 (A:) iota-carrageenase {Alteromonas sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 12. Search Result.
A calmodulin-like domain protein kinase (DcCPK1, previously designated CDPK431) cloned from carrot (Daucus carota L.) was expressed at high levels in Escherichia coli and partially purified.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Ph.D., Biology, University of California, 1983 jung.choi@biology.gatech.edu Phone: (404) 894-8423 Fax: (404) 894-0519 Office: (Cherry Emerson) 213/210
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: array_element_name array_element_type organism is_control locus description is_ambiguous chromosome start stop 18001_at oligonucleotide Arabidopsis thaliana no AT1G01040 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: -- dump date 20030806 -- class Genbank::CDS -- table CDS_note -- id note 15223276 contains Pfam PF02365: No apical meristem (NAM) domain similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana] 15223284 similar to DNA-binding proteins from [Arabidopsis thaliana] RAV1
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Blast performed on July-31-2007 BLASTP 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: The Plant Journal (1999) 18(1), 4355 Isolation, characterization and immunolocalization of a novel, modular tomato arabinogalactan-protein corresponding to the LeAGP-1 gene Minggeng Gao1, Marcia J. Kieliszewski2, Derek T.A. Lamport3 and Allan M.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Generated from scop database 1.71 with scopm 1.101 on Fri Oct 20 11:07:05 2006 Copyright © 1994-2005 The scop authors / scop@mrc-lmb.cam.ac.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: The formin family of proteins has been implicated in signaling pathways of cellular morphogenesis in both animals and fungi; in the latter case, at least, they participate in communication between the actin cytoskeleton and the cell surface.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
