+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : erwinia]
Cluster 1354 with 4 members. d1h80a__2. b.80.1.8 (A:) iota-carrageenase {Alteromonas sp.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: >d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi} attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Structure: 1. Pectin methylesterase. Fragment: mature enzyme (residues 25-366). Synonym: pectinesterase. Source: 1. Erwinia chrysanthemi. Strain: b374. Cellular_location: extracellular. Gene: pema. Expression_system_cellular_location: secreted.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Generated from scop database 1.71 with scopm 1.101 on Fri Oct 20 11:07:05 2006 Copyright © 1994-2005 The scop authors / scop@mrc-lmb.cam.ac.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Ľ0>0@0“ĘĆ==ůKŃ€•(Ficus microcarpa L. f. var. pusilifolia Liao cv. Kin-men) -I•(Ficus microcarpa L. f. cv. Middle-leaf)ĘOq0@KI•(Ficus microcarpa L. f. var.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: We hypothesized that the daffodil gene encoding phytoene synthase (psy), one of the two genes used to develop Golden Rice, was the limiting step in b-carotene accumulation.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: RESOLUCION 451 Norma Andina sobre requisitos fitosanitarios de aplicación al comercio de productos agrícolas (Modificación del Anexo 1 de la Resolución 431) LA JUNTA DEL ACUERDO DE CARTAGENA,
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Nova Biotechnologica (2004) 83 INHIBI NÝ Ú INOK RASTLINNÝCH MACERÁTOV NA FYTOPATOGÉNNE BAKTÉRIE FRANTI`EK GAGO, MARTIN PAJTINKA, EVA pRGEOVÁ Katedra biotechnológií, Fakulta prírodných vied Univerzity sv. Cyrila a Metoda v Trnave, Nám. J.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: x “ w 1. xë: Ë-'xxű 1990-1994 Experience 2. v :ĺ,q'xzł Kv@ 1994-1995 3. ©ë:ĺ,q'xzłP Kx; 1995-1997 4. Zë:ĺ,q'xzłP Kx; 1997-2000 5.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 10. A3516.fm.
Not so in the bacterial realm where the number of known bacterial predators is small and their phylogenetic affiliations largely unknown.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Cabbage Maggot Karen Delahaut, UW-Madison Fresh Market Vegetable Program The cabbage maggot (Delia radicum) is a pest of cole crops including cabbage, broccoli, Brussels sprouts, cauliflower, and rutabaga. Cabbage maggots damage plants by feeding on the roots and lower stem of plants.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
