+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : esculentum]
The conversion of provitamin D to previtamin D is a photochemical reaction requiring ultraviolet-B photons. ` Not only vitamin D2 but also vitamin D3 have been found in a variety of plants.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: 2. Appendix a.
Approximately 25% of the species have not been relocated, and are presumed to have disappeared from the property.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Sept. 1974-March 1977, MS Chairman - Effects of storage conditions, growth regulators, and maturity on ATP content and seedling vigor of vegetable seeds.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: urpose - This garden highlights issues of hunger, food, and nutrition. It presents common and easy to grow vegetables. The vegetables in this garden are planted, tended and harvested by 4-H club members. Many of the vegetables are donated to the local food shelf.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 5 m away from the treated wood (<3 10 mg kg 1 As). Four replicates of carrot (Daucus carota var. sativus Hoffm. cv. Thumbelina), spinach (Spinacia oleracea L. cv. Indian Summer), bush bean (Phaseolus vulgaris L. cv. Provider), and buckwheat (Fagopyrum esculentum Moench cv.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Contents: 1. Standardisation of propagation techniques by cutting of some tropical fruit crops/S.K. Mitra & T.K. Bose. 2. Response of varying concentrations of boron in yield and quality of grapes (Vitis vinifera L.)/B. Singh & P. Rethy. 3. Biochemical changes in litchi (cv.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: {Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: AC: RSP00001//OS: tomato (Lycopersicon esculentum) /GENE: pds/RE: Pds/Le element /BF: unknown nuclear factor 2. AC: RSP00002//OS: Brassica napus /GENE: Oleosin/RE: ABRE-3 /BF: B.napus embryo protein factor 3.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: var. Capitata cv. Pronzwik), carrot (Daucus carota L. cv. Natus), cucumber (Cucumis sativus L. cv. Beithalpha), squash (Cucurbita pepo L. cv. Byrouti), onion (Allium cepa L. cv. Texas Early Grana), pepper (Capsicum annum L. cv. Red Common), or tomato (Lycopersicon esculentum Mill cv.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: distichon) 'Malt' barley - very young seedlings are dried to produce malt which contains enzymes that convert starch to sugars.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: gi|22947852|gb|AAN07898.1| xyloglucan endotransglycosylase [Malus x domestica] Match: gi|19911573|dbj|BAB86890.1| score: 359.8 e-value: 2.1e-98 Identity: 82.41% Span: 597bp (82.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Evaluación de nuevos cultivos como okra y calabaza aceitera. Modelos de crecimiento y desarrollo en brassicas. Nueva alternativa productiva para el secano costero con alcachofas. Consumo de agua en cultivos bajo invernadero a través de la medición del flujo de savia.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Poudel, D., D. Midmore and L. West. 2000. Farmer participatory research to minimize soil erosion on steep land vegetable systems in the Philippines. Agriculture, Ecosystems and Environment. 79: 113-127.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Query sequence: S48L12 (690 letters) Database: ./db/nr 2,304,535 sequences; 784,226,776 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC44500.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: distichon) 'Malt' barley - very young seedlings are dried to produce malt which contains enzymes that convert starch to sugars.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: ERF/AP2IDS1Zea mays indeterminate spikelet1 (ids1) AF048900 PUT-151a-Zea_mays-101615 11669.m06144 MZ00027885 MZ00040412 1.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: distichon) 'Malt' barley - very young seedlings are dried to produce malt which contains enzymes that convert starch to sugars.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: 986 20 ACCCGAGATTGTTGGTTGAG 59.966 20 217 15 231 AGCTCAGTCCTCCACTTCCA 59.986 20 AATCGTTTGTAGCTGTCGGG 60.132 20 240 15 254 GGATTCCCAAACTCCGAAAT 60.131 20 ACCCGAGATTGTTGGTTGAG 59.966 20 140 92 231 >TA17352_4081 1 p1 (A)10 10 518 527 GGGCTTTTTGTGTAAAGGGTT 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Por la presente Orden se incorpora al ordenamiento jurídico interno la Directiva 2006/124/CE de la Comisión, de 5 de diciembre de 2006, mediante las adecuadas modi- ficaciones de los reglamentos citados en el párrafo ante- rior.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
