Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
178 site(s)
PR 4
620 site(s)
PR 3
872 site(s)
PR 2
513 site(s)
PR 1
199 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : hypothetical]


Sort By :
The American Presidency Project contains the most comprehensive collection of resources pertaining to the study of the President of the United States. Compiled by John Woolley and Gerhard Peters at the University of California.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The President. I don't want to have a captive audience, but there are a couple of things that I did want to say -- make a statement here. I'd like to make just a few comments, after which I'll be glad to take a couple of questions.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

factormedian_fitted_datamedian_fitted_datagene annotationgene annotation condition1condition0(CONTROL)condition1functional categorydescription VBVHG06?
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

{Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

, Konto-Nummer: 847 58 - 672, BLZ: 545 100 67 Rundschreiben 3 / 2000 November 2000 Internationale Biometrische Gesellschaft - Deutsche Region: Rundschreiben 3/2000 2 Inhalt - Grußworte 3 - Bericht vom IBS-Council-Meeting 6.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

103e-277 T20O9TF : Page 1 of HTML SIMILAR TO: gi|2351072|dbj|AB006707|AB006707 Arabidopsis thaliana genomicDNA, chromosome 5, P1 clone: MYC6 PVALUE: 6.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Probe Set AGI Data Source Criterion for Match TIGR Description 13254_at AT4G17190 TIGR ATH1.seq 100 percent over >= 50 bp, unique. farnesyl pyrophosphate synthetase 2 (FPS2) [farnesyl diphosphate synthase 2] / identical to GB:46350; supported by cDNA: gi_1146162_gb_L46349.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

-- dump date 20030806 -- class Genbank::CDS -- table CDS_note -- id note 15223276 contains Pfam PF02365: No apical meristem (NAM) domain similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana] 15223284 similar to DNA-binding proteins from [Arabidopsis thaliana] RAV1
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

This list last updated July 19, 2002 Note: Assembly 1 was done on Jan 29, 2001. Assembly 2 was done on April 1, 2002. \N indicates that the EST is a singleton.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

ID AJ890364 preliminary; circular genomic DNA; VRL; 407339 BP. XX AC AJ890364; XX SV AJ890364.1 XX DT 16-MAR-2005 (Rel. 83, Created) DT 16-MAR-2005 (Rel. 83, Last updated, Version 0) XX DE Emiliania huxleyi virus isolate EhV86 XX KW complete genome.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

SIMAP is a fast and flexible database that provides precomputed homologies of the most known protein sequences. The core of this dataset is created by extensive Fasta searches with appropriate settings to optimal sensitivity.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

minmatch = Minimum length of matching word required to nucleate SWAT comparison. minscore = Minimum alignment score minlength = Minimum size in basepairs of sequences of sequences selected for this assembly. For more information see: http://www.phrap.org/phrap.docs/phrap.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

(c) 1992-2000 Regents of the University of California, Santa Cruz Sequence Alignment and Modeling Software System http://www.cse.ucsc.edu/research/compbio/sam.html
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

986 20 ACCCGAGATTGTTGGTTGAG 59.966 20 217 15 231 AGCTCAGTCCTCCACTTCCA 59.986 20 AATCGTTTGTAGCTGTCGGG 60.132 20 240 15 254 GGATTCCCAAACTCCGAAAT 60.131 20 ACCCGAGATTGTTGGTTGAG 59.966 20 140 92 231 >TA17352_4081 1 p1 (A)10 10 518 527 GGGCTTTTTGTGTAAAGGGTT 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Blast performed on April-8-2007 BLASTP 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Probe Set AGI Data Source Criterion for Match TIGR Description 13254_at AT4G17190 TIGR ATH1.seq 100 percent over >= 50 bp, unique. farnesyl pyrophosphate synthetase 2 (FPS2) [farnesyl diphosphate synthase 2] / identical to GB:46350; supported by cDNA: gi_1146162_gb_L46349.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

172 22 AAAGCTCTTCATGGGAGCAA 59.955 20 228 4 231 GCGGGACACAGAACTTCTTTAC 60.172 22 GGAGCAACACCCTGAATGAT 59.934 20 215 4 218 GCGGGACACAGAACTTCTTTAC 60.172 22 ACATTTGCAGCCATTTCCTC 60.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: 1 2 [Next >]



Valid XHTML 1.0 Transitional   Valid CSS