+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6596
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : medicago]
i] A GRICUL TURE 99 'rABLE II-(continued) PRINCIPAL CROPS CULTIVATED IN INDIA Botanical Name. English Name. Vernacular stNaime in Hindustani. --igaed Garden, C'ros. Saccharum officinarum . . Sugar-cane . Ukh or lkh. Zingiber officinale . . Ginger . Adrak or Sonth. Curcuma longa . . . Turmeric .
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: La metahemoglobinemia reduce la capacidad de transporte de oxígeno por la sangre y además cambia la curva de disociación de oxihemoglobina hacia la izquierda lo cual interfiere con la descarga de oxígeno. Puede ocurrir también hipotensión y colapso.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: NATIONAL VARIETY LIST/NASIONALE VARIëTEITSLYS II DENOMINATIONS\BENAMINGS II.A Applications for variety denominations/Aansoeke on variëteitsbenamings Vide I.a II.B Applications for approval of alterations of denominations/Aansoeke om goedkeuring vir die wysiging van benamings A pplication
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Many cultivated crops have sexually compatible wild relatives with which they hybridize under favorable circumstances. The table below provides some of the documented instances of hybridization between crops and weeds.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 5. Plant Names.
Hordeum vulgare Phaseolus sp. Andropogon sp. Kochia scoparia Andropogon gerardi Sarcobatus vermiculatus Lesquerella sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Information on this website is for educational purposes only. Many herbs historically used for medicine are considered too toxic to use today; some of these herbs have caused deaths. Do not ingest these herbs based on information on this website.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: (rat) 871,163 Ciona intestinalis 686,396 Xenopus laevis (African clawed frog) 677,784 Sus scrofa (pig) 641,896 Gallus gallus (chicken) 599,330 Drosophila melanogaster (fruit fly) 532,557 Hordeum vulgare + subsp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: In vivo Lokalisierung von strukturellen und regulatorischen Komponenten von COPI-coated Vesikeln in Medicago truncatula cv. Jemalong Wurzelzellen Dissertation zur Erlangung des akademischen Grades Doktor der Naturwissenschaften (Dr. rer. nat.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 10. crop species.
crop species pollination area where grown compatible relatives alfalfa Medicago sativa mostly cross-pollinated USA wild alfalfa Medicago sativa asparagus Asparagus officinalis mostly cross-pollinated USA wild asparagus Asparagus officinalis blueberry Vaccinium angustifolium mostly
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Agronomic performance and genetic diversity of the root crop yam bean (Pachyrhizus spp.) under West African conditions / Ahissou Séraphin Zanklan. - Electronic edition.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: This page was last modified Sept. 13, 2006. A link to P450 functions in plants an extensive listing with references. From the Plant Biotechnology Institute, National Research Council, Saskatoon, Saskatchewan CANADA Plant P450s that have appeared since the 1993 P450 nomenclature update.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Supplemental Table II â Top 200 ESTs LEAVES TC Leaf P(leaf) Total 32789 32789 Singleton 3777 3777 Counted 29012 29012 1 TC35585: chlorophyll a/b binding protein {Medicago sativa} 464 15.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 14. dbEST Summary.
(rat) 871,163 Ciona intestinalis 686,396 Xenopus laevis (African clawed frog) 677,784 Sus scrofa (pig) 641,896 Gallus gallus (chicken) 599,330 Drosophila melanogaster (fruit fly) 532,557 Hordeum vulgare + subsp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 15. P04-077 Costea.
The biology of Canadian weeds. 133. Cuscuta campestris Yuncker, C. gronovii Willd. ex Schult., C. umbrosa Beyr. ex Hook., C. epithymum (L.) L. and C. epilinum Weihe. Mihai Costea1 and François J.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: BLASTX 2.2.2 [Dec-14-2001] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: ) Pest risk analyst: EPPO Secretariat Draft 07 March 2006 (editorial modifications by EPPO Secretariat in 2006-07) Stage 1: Initiation 1 What is the reason for performing the PRA? Identification of a single pest Solanum elaeagnifolium has been declared as an invasive plant in many countries.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: introduction: Traditionally, a large number of different herbs have been used to affect different aspects of the activity of the female reproductive tract.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: 20. Lends.
BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
