+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : medicago]
21. dbEST Summary.
Homo sapiens (human) 7,893,983 Mus musculus + domesticus (mouse) 4,720,064 Oryza sativa (rice) 1,188,565 Zea mays (maize) 1,143,728 Bos taurus (cattle) 1,137,353 Danio rerio (zebrafish) 1,134,553 Xenopus tropicalis 1,044,182 Rattus norvegicus + sp.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: BLASTX 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Thrips species collected from areas in Australia surveyed for Caliothrips fasciatus. Date Location and State GPS Coordinates and Elevation Scientific Plant Name Thrips Species Collected 12/26/04 Brisbane International Airport; QLD S27o 24.166; E153o 06.492; 0m Peltophorum sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: l-homocysteine and isoformononetin (4'-hydroxy-7-methoxyisoflavone) refined to 1.4 Å. These two OMTs constitute the first plant methyltransferases to be structurally characterized and reveal a novel oligomerization domain and the molecular determinants for substrate selection.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: FASTA searches a protein or DNA sequence data bank version 3.3t07 Sept. 19, 2000 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 At1g12220.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Braca, A. Bader, T. Siciliano, I. Morelli, N. De Tommasi, New pyrrolizidine alkaloids and glycosides from Anchusa strigosa, Planta medica, vol. 69, pp. 835-841, 2003 G. Flamini, P.L. Cioni, I. Morelli, Volatiles from leaves, fruits, and virgin oil from Olea europaea Cv.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Pages: [< Previous] 1 2
