Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
178 site(s)
PR 4
620 site(s)
PR 3
872 site(s)
PR 2
513 site(s)
PR 1
199 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : mus]


Sort By :
3.6.1.4 scorpion toxin {(Androctonus australius hector), toxin II} vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp grch >d1cex__ 3.14.7.1.1 Cutinase {fungus (Fusarium solani, subsp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

N-acetyl-L-glutamate and the u ...fish, shark, trout, Squalus acanthias, Micropterus salmoides, Opsanus beta, Oncorhynchus mykiss, Batrachoididae gen. sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

!!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383 February 19, 1999 15:06 REFORMAT of: seq.seq check: 4199 from: 1 to: 383 February 19, 1999 15:04 (No documentation) TO: SwissProt:* Sequences: 71,248 Symbols: 25,831,459 Word Size: 2 Databases searched: SWISS-PROT, Release 35.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Domain architecture information on representative(s) of the 44 S60 cluster(s) of the current cluster.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

(c) 1992-2000 Regents of the University of California, Santa Cruz Sequence Alignment and Modeling Software System http://www.cse.ucsc.edu/research/compbio/sam.html
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

gi|15240922|ref|NP_198663.1| DNA repair protein RAD23, putative [Arabidopsis thaliana] gi|9758825|dbj|BAB09359.1| DNA... Match: gi|30409726|dbj|BAC76393.1| score: 335.5 e-value: 1.5e-90 Identity: 75.7% Span: 744bp (44.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

gi|4826964|ref|NP_005044.1| UV excision repair protein RAD23 hom... 112 2e-24 gi|31541878|ref|NP_080596.2| RIKEN cDNA 2310040G17 [Mus musculus... 111 4e-24 gi|26332489|dbj|BAC29962.1| unnamed protein product [Mus musculus] 111 4e-24 gi|6679605|ref|NP_033036.1| RAD23a homolog [Mus musculus] >gi|17...
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

BLASTX 2.2.2 [Dec-14-2001] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

gi|18265391|gb|AAL67159.1|AF323993_1 histone H3.3 [Trichinella p... 263 2e-69 gi|17567723|ref|NP_509344.1| Core histone H2A/H2B/H3/H4 (15.3 kD... 263 2e-69 gi|12847552|dbj|BAB27616.1| unnamed protein product [Mus musculus] 191 2e-69 gi|27718971|ref|XP_235304.1| similar to H3 histone, family 3B [R...
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>gi|119503|sp| P03384| ENV_WMSV Envelope glycoprotein (Env polyprotein) [Contains: Transmembrane protein (Envelope protein p15E); R-peptide (p2E)] >gi| 1335598| emb| CAA24517.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BLAST RESULT C300R BLAST Results blastp vs ( PBCV-1, NY2A, AR158, MT325, CVM-1, ecoli, mimivirus.aa, EsV, CNPV, Ehv-1 ) on GreenGene Genome Hit Hit ID Q:From--To H:From--To Align_Len E_value Identity Positive More Detail AR158.aa C300R 1-1 1--288 1--288 288 0.00000 95% 95% More
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

--- AA158957 zo60a12.r1 Stratagene pancreas (#937208) Homo sapiens cDNA clone --- (401 bases) |SCO: 1.38|POS:105-140|MIS: 0|WOB: 2| |CUG|CUGAUGA|GAA|U|UUC|AAA|AG|GAAGUCUC|CU|U|UGG| --- AA160747 zo62a05.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:



Valid XHTML 1.0 Transitional   Valid CSS