Browse by Tag: oryza

ADD A LISTING

+ Main Category

Crops: 6288

Biology: 168

Research: 792

Business: 40

Home Gardening: 100

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

+ Top 10

Pomology: Fruit Cultivation and Production

TropHort: Biology, Agriculture, Horticulture and Forestry

Producing Vegetable Crops 5th Edition by John M. Swiader.

Asparagus - Wikipedia, the free encyclopedia

Broccoli.

Microsoft Word - Bell pepper lesson.doc.

Texas A&M University System Research & Extension Center at Stephenville - Horticulture.

Veg&Fruit2007:Layout 1.

Alleviating malnutrition through agriculture in Bangladesh.

Life and Earth Sciences Social Network

+ Directory Statistics

Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7

2 site(s)

PR 6

27 site(s)

PR 5

178 site(s)

PR 4

620 site(s)

PR 3

872 site(s)

PR 2

513 site(s)

PR 1

199 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.

Web Links [Tag : oryza]

1. Botany 2000 - Physiological Section Index, By Title.

Novel lysine-rich arabinogalactan with regulatory effects on carrot (Daucus carota) cells growth and differentiation, A. - PEREIRA-NETTO, ADAUCTO B.*, JULIANA M. MENESTRINA, ANA MARIA A. CARNEIRO LEAO, AND MARCELO IACOMINI.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

2. ESTree: blast output page.

Query sequence: S39K5 (611 letters) Database: ./db/nr 2,304,535 sequences; 784,226,776 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM81202.1| calmodulin 1 [Medicago truncatula] >gi|5825598|gb...

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

3. Microsoft Word - Publ2002.doc.

1 Institut für Agrikulturchemie Carl-Sprengel-Weg 1 Georg-August-Universität D-37075 Göttingen Göttingen Telefon: 0551 - 39 55 68 Fax: 0551 - 39 55 70 e-mail: uaac@gwdg.de Verzeichnis der Veröffentlichungen (List of publications) 2002 P Adgo, E. & Schulze, J.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

4. YˆáoUe.

1.™ÆöÄ iúàŒv/¨P„»tš, ý¶ê6ÑfúÑD©yî2004t1ó2006t12;

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

5. Seq_Name Matching_Seq Putative_Function SSR_Num SSR_Type SSR SSR_size...

{Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

6. >K0_1 No match I:0 Q:0 S:0 Full:0...

>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

7. GiardiaDB.

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

8. SoftBerry - regsitelist.

AC: RSP00001//OS: tomato (Lycopersicon esculentum) /GENE: pds/RE: Pds/Le element /BF: unknown nuclear factor 2. AC: RSP00002//OS: Brassica napus /GENE: Oleosin/RE: ABRE-3 /BF: B.napus embryo protein factor 3.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

9. SGN Unigene - Show All Stored BLAST Hits.

gi|15240922|ref|NP_198663.1| DNA repair protein RAD23, putative [Arabidopsis thaliana] gi|9758825|dbj|BAB09359.1| DNA... Match: gi|30409726|dbj|BAC76393.1| score: 335.5 e-value: 1.5e-90 Identity: 75.7% Span: 744bp (44.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

10. bpg000270global_homology 3 studies Consensus:3.1.4.11 GOIEAEC...

bpg000270global_homology 3 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.- bpg000275global_homology 2 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

11. This list last updated July 19, 2002 Note: Assembly 1 was done on Jan...

This list last updated July 19, 2002 Note: Assembly 1 was done on Jan 29, 2001. Assembly 2 was done on April 1, 2002. \N indicates that the EST is a singleton.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

12. BLASTX 2.2.8 [Jan-05-2004] Reference: Altschul, Stephen F., Thomas L....

BLASTX 2.2.8 [Jan-05-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

13. Over-expression of a single Ca2+-dependent protein kinase confers both cold and salt/drought tolerance on rice plants. ...

Using protein sequence data obtained from a calcium- and phospholipid-regulated protein kinase purified from maize (Zea mays), we isolated a cDNA encoding a calcium-dependent protein kinase (CDPK), which we designated ZmCPK11.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

14. PGN - Unigene Summary.

60S acidic ribosomal protein P0 [Oryza sativa (japonica cultivar-group)] dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa (japonica cultivar-group)] dbj|BAA04668.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

15. SGN Unigene - Show All Stored BLAST Hits.

gi|22947852|gb|AAN07898.1| xyloglucan endotransglycosylase [Malus x domestica] Match: gi|19911573|dbj|BAB86890.1| score: 359.8 e-value: 2.1e-98 Identity: 82.41% Span: 597bp (82.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

16. GenRE - SIMAP Homologs.

SIMAP is a fast and flexible database that provides precomputed homologies of the most known protein sequences. The core of this dataset is created by extensive Fasta searches with appropriate settings to optimal sensitivity.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

17. Detailed annotation info for ACL00002374.

1| AT3g27360/K1G2_6 [Arabidopsis thaliana] gb|AAL87394.1| AT5g65360/MNA5_9 [Arabidopsis thaliana] gb|AAM60903.1| histone H3-like protein [Arabidopsis thaliana] dbj|BAC01212.1| putative histone H3 [Oryza sativa (japonica cultivar-group)] gb|AAM95675.1| histone H3 [Orobanche cumana] dbj|BAC21299.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

18. Nucleo e Cromosomi l PROCARIOTI Cromosoma (nucleoide), plasmidi,...

R. Rao Nucleo e cromosomi n° 3 Cromosoma Eucariotico Nucleare I cromosomi sono costituiti da cromatina La cromatina è costituita: Proteine DNA RNA Proteine istoniche Proteine acide Prof R.Rao Nucleo e cromosomi n° 4 Cromatina eucromatina eterocromatina Prof. R.

Details Hits: 1 Votes: 0 Ratings:

Reviews:

Google PR:

19. People in Genetics at UGA.

My current projects are focused on the structural characterization and mapping of gene-free regions of the maize (Zea mays, L.) genome, the structural characterization of onion (Allium cepa, L.) and asparagus (Asparagus officinalis, L.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

20. ESTree: blast output page.

Query sequence: S48L12 (690 letters) Database: ./db/nr 2,304,535 sequences; 784,226,776 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC44500.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

Pages: 1 2 [Next >]