Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
178 site(s)
PR 4
620 site(s)
PR 3
872 site(s)
PR 2
513 site(s)
PR 1
199 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : pectin]


Sort By :
3/4 cup bell pepper, ground 1 cup apple cider vinegar 1/4 cup jalapeno peppers (seeds ground) 1 bottle liquid pectin 5 cups sugar Green food coloring Mix together peppers, sugar and vinegar. Bring to boil. Boil 5 minutes. Cool. Add pectin. Add green food coloring.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Generated from scop database 1.71 with scopm 1.101 on Fri Oct 20 11:07:05 2006 Copyright © 1994-2005 The scop authors / scop@mrc-lmb.cam.ac.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Lineage Root 1. Class All beta proteins [48724] (48724) 2. Fold Single-stranded right-handed beta-helix (51125) superhelix turns are made of parallel beta-strands and (short) turns 3. Superfamily Pectin lyase-like (51126) superhelix turns are made of 3 strands each 4. Family Pectin
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Generated from scop database 1.69 with scopm 1.101 on Fri Jul 29 15:51:10 2005 Copyright © 1994-2005 The scop authors / scop@mrc-lmb.cam.ac.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pectin methylesterase (PME) is a key enzyme in fruit and vegetable processing. It catalyzes the deˇVesterification of pectin forming acidic pectin, which is an ideal substrate for polygalacturonase (PG), a pectin depolymerizing enzyme.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Cluster 1354 with 4 members. d1h80a__2. b.80.1.8 (A:) iota-carrageenase {Alteromonas sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi} attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The concept of thermal processing of foods is commonly used despite its adverse effect on nutritional and organoleptic qualities. Nowadays, consumer preferences move towards healthier and more fresh like foods.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Structure: 1. Pectin methylesterase. Fragment: mature enzyme (residues 25-366). Synonym: pectinesterase. Source: 1. Erwinia chrysanthemi. Strain: b374. Cellular_location: extracellular. Gene: pema. Expression_system_cellular_location: secreted.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Cell wall structural changes: towards understandingtexture evolution of high pressure pretreated thermally processed carrots The concept of thermal processing plant based foods is commonly used despite its adverse effect on nutritional and organoleptic qualities.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

HEADER PECTIN METHYLESTERASE 20-NOV-01 1GQ8 TITLE PECTIN METHYLESTERASE FROM CARROT COMPND MOL_ID: 1; COMPND 2 MOLECULE: PECTIN METHYLESTERASE; COMPND 3 CHAIN: A; COMPND 4 EC: 3.1.1.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Plant Molecular Biology 47: 311340, 2001. © 2001 Kluwer Academic Publishers. Printed in the Netherlands. 311 Cell wall metabolism in fruit softening and quality and its manipulation in transgenic plants David A. Brummell and Mark H.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Twenty-two male and fifteen female CHD outpatients with recently diagnosed hypercholesterolemia were enrolled into the study. Each patient received dietary counseling and the booklet that contains the instruction for controlling cholesterol level.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

OAES horticulture researchers are looking at what happens when plant bacterial spot attacks bell peppers. They wanted to look close-at the cellular level-to see what defense mechanisms go into action when a pathogen threatens.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Hort 100 -- Exam No. 1 -- Fall, 1995 -- Name _________________________ I. Multiple choice. Choose the best answer, circle the letter corresponding to that answer, and write the letter in the space provided (2 points each).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Hort 100 -- Exam No. 1 -- Fall, 1995 -- Name _________________________ I. Multiple choice. Choose the best answer, circle the letter corresponding to that answer, and write the letter in the space provided (2 points each).
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Giant panda is an indigenous and endangered species in China.It was discussed that the utilization of cell wall of bamboo by giant panda at the morphological viewpoint.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:



Valid XHTML 1.0 Transitional   Valid CSS