Browse by Tag: sapiens

ADD A LISTING

+ Main Category

Crops: 6288

Biology: 168

Research: 792

Business: 40

Home Gardening: 100

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

+ Top 10

Pomology: Fruit Cultivation and Production

TropHort: Biology, Agriculture, Horticulture and Forestry

Producing Vegetable Crops 5th Edition by John M. Swiader.

Asparagus - Wikipedia, the free encyclopedia

Broccoli.

Microsoft Word - Bell pepper lesson.doc.

Texas A&M University System Research & Extension Center at Stephenville - Horticulture.

Veg&Fruit2007:Layout 1.

Alleviating malnutrition through agriculture in Bangladesh.

Life and Earth Sciences Social Network

+ Directory Statistics

Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7

2 site(s)

PR 6

27 site(s)

PR 5

178 site(s)

PR 4

620 site(s)

PR 3

872 site(s)

PR 2

510 site(s)

PR 1

200 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.

Web Links [Tag : sapiens]

1. >d1cbn__ 7.12.1.1.1 Crambin {abyssinian cabbage (Crambe abyssinica)}...

3.6.1.4 scorpion toxin {(Androctonus australius hector), toxin II} vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp grch >d1cex__ 3.14.7.1.1 Cutinase {fungus (Fusarium solani, subsp.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

2. >d1cbn__ 7.11.1.1.1 Crambin [abyssinian cabbage (Crambe abyssinica)]...

>d1cbn__ 7.11.1.1.1 Crambin [abyssinian cabbage (Crambe abyssinica)] TTCCPSIVARSNFNVCRLPGTPEALCATYTGCIIIPGATCPGDYAN >d2erl__ 1.10.1.1.1 ER-1 [Euplotes raikovi] DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV >d8rxna_ 7.34.3.1.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

3. Reference to EC Number 2.1.3.3, ReferenceID= 485916.

N-acetyl-L-glutamate and the u ...fish, shark, trout, Squalus acanthias, Micropterus salmoides, Opsanus beta, Oncorhynchus mykiss, Batrachoididae gen. sp.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

4. Any question? - Use the BRENDA Discussion groups.

Please wait a moment until all data are loaded. Otherwise you are not able to jump to every subitem in the left navigation! This message will disappear when all data are loaded.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

5. !!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383...

!!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383 February 19, 1999 15:06 REFORMAT of: seq.seq check: 4199 from: 1 to: 383 February 19, 1999 15:04 (No documentation) TO: SwissProt:* Sequences: 71,248 Symbols: 25,831,459 Word Size: 2 Databases searched: SWISS-PROT, Release 35.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

6. Homology models For the WD DOMAIN.

Domain architecture information on representative(s) of the 44 S60 cluster(s) of the current cluster.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

7. a2m2html output for file tmp.a2m.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

8. F2J16TF : Page 1 of HTML SIMILAR TO: gi|2191157|gb|AF007270|IG002P16...

103e-277 T20O9TF : Page 1 of HTML SIMILAR TO: gi|2351072|dbj|AB006707|AB006707 Arabidopsis thaliana genomicDNA, chromosome 5, P1 clone: MYC6 PVALUE: 6.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

9. -- dump date 20030806 -- class Genbank::CDS -- table CDS_note -- id...

-- dump date 20030806 -- class Genbank::CDS -- table CDS_note -- id note 15223276 contains Pfam PF02365: No apical meristem (NAM) domain similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana] 15223284 similar to DNA-binding proteins from [Arabidopsis thaliana] RAV1

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

10. This list last updated July 19, 2002 Note: Assembly 1 was done on Jan...

This list last updated July 19, 2002 Note: Assembly 1 was done on Jan 29, 2001. Assembly 2 was done on April 1, 2002. \N indicates that the EST is a singleton.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

11. BLASTX 2.2.8 [Jan-05-2004] Reference: Altschul, Stephen F., Thomas L....

BLASTX 2.2.8 [Jan-05-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

12. Alignment view : PH1796.

BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

13. GEISHA BLASTX report for D02_T3.

gi|4826964|ref|NP_005044.1| UV excision repair protein RAD23 hom... 112 2e-24 gi|31541878|ref|NP_080596.2| RIKEN cDNA 2310040G17 [Mus musculus... 111 4e-24 gi|26332489|dbj|BAC29962.1| unnamed protein product [Mus musculus] 111 4e-24 gi|6679605|ref|NP_033036.1| RAD23a homolog [Mus musculus] >gi|17...

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

14. Any question? - Use the BRENDA Discussion groups.

Please wait a moment until all data are loaded. Otherwise you are not able to jump to every subitem in the left navigation! This message will disappear when all data are loaded.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

15. /:swissnew|O86956|MGTA_THENE :4-ALPHA-GLUCANOTRANSFERASE (EC...

/:swissnew|O86956|MGTA_THENE :4-ALPHA-GLUCANOTRANSFERASE (EC 2.4.1.25) (AMYLOMALTASE) (DISPROPORTIONATING ENZYME) (D-ENZYME).//:gp|AJ009831|3378519 4-alpha-glucanotransferase [Thermotoga neapolitana] /:swissnew|O86956|MGTA_THENE :4-ALPHA-GLUCANOTRANSFERASE (EC 2.4.1.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

16. BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L....

BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

17. GiardiaDB.

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.

Details Hits: 1 Votes: 0 Ratings:

Reviews:

Google PR:

18. SWBIC - Batch BLAST results.

BLASTX 2.2.2 [Dec-14-2001] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.

Details Hits: 1 Votes: 0 Ratings:

Reviews:

Google PR:

19. 1 R687 0 group_1_ D23969 1 C161 0.3 group_1_ D15147 1 C602 0.6...

1 R687 0 group_1_ D23969 1 C161 0.3 group_1_ D15147 1 C602 0.6 group_1_ D15413 ribosomal protein S5 homolog Nicotiana tabacum 230 1 S1442 5.3 group_1_ D39825 1 C970 5.6 group_1_ D15622 1 S1543 5.6 group_1_ D39891 1 S10623 7 group_1_ D46151 leucyl-tRNA synthetase (EC 6.1.1.

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

20. GEISHA BLASTX report for 06J_T7.

gi|18265391|gb|AAL67159.1|AF323993_1 histone H3.3 [Trichinella p... 263 2e-69 gi|17567723|ref|NP_509344.1| Core histone H2A/H2B/H3/H4 (15.3 kD... 263 2e-69 gi|12847552|dbj|BAB27616.1| unnamed protein product [Mus musculus] 191 2e-69 gi|27718971|ref|XP_235304.1| similar to H3 histone, family 3B [R...

Details Hits: 0 Votes: 0 Ratings:

Reviews:

Google PR:

Pages: 1 2 [Next >]