Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
178 site(s)
PR 4
620 site(s)
PR 3
872 site(s)
PR 2
510 site(s)
PR 1
200 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : sativa]


Sort By :
A Unimonte sempre está de portas abertas à comunidade. Seja para uma visita pelas instalações, para prestação de serviços, para utilização de espaços de estudos, ou mesmo para um simples cafezinho. Essa é a proposta: educar, atender e servir! universidade, centro universitário, educação, ies,
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

NATIONAL VARIETY LIST/NASIONALE VARIëTEITSLYS II DENOMINATIONS\BENAMINGS II.A Applications for variety denominations/Aansoeke on variëteitsbenamings Vide I.a II.B Applications for approval of alterations of denominations/Aansoeke om goedkeuring vir die wysiging van benamings A pplication
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Aster, Callistephus chinensis (China aster), Daucus carota (Zanahoria), Gladiolus (Gladiolo), Hordeum vulgare (Cebada), Lactuca sativa (Lechuga), Linum usitatissimum (Lino), Lycopersicon esculentum (Tomate), Solanum tuberosum (Papa), Spinacia oleracea (Espinaca).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Many cultivated crops have sexually compatible wild relatives with which they hybridize under favorable circumstances. The table below provides some of the documented instances of hybridization between crops and weeds.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Plants 5 - 1 Bio 112 Handout for Plants 5 This handout contains: " Todays iClicker Questions " Handouts for todays lecture iClicker Question #14A - before lecture Scientifically speaking, which of the following are fruits? A. tomato B. cucumber C. potato D. carrot E.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Hordeum vulgare Phaseolus sp. Andropogon sp. Kochia scoparia Andropogon gerardi Sarcobatus vermiculatus Lesquerella sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

{Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

AC: RSP00001//OS: tomato (Lycopersicon esculentum) /GENE: pds/RE: Pds/Le element /BF: unknown nuclear factor 2. AC: RSP00002//OS: Brassica napus /GENE: Oleosin/RE: ABRE-3 /BF: B.napus embryo protein factor 3.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Information on this website is for educational purposes only. Many herbs historically used for medicine are considered too toxic to use today; some of these herbs have caused deaths. Do not ingest these herbs based on information on this website.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

(rat) 871,163 Ciona intestinalis 686,396 Xenopus laevis (African clawed frog) 677,784 Sus scrofa (pig) 641,896 Gallus gallus (chicken) 599,330 Drosophila melanogaster (fruit fly) 532,557 Hordeum vulgare + subsp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

*For correspondence (fax +31 20 5257934; e-mail hartog@bio.uva.nl). Summary Rhizobium-secreted nodulation factors are lipochitooligosaccharides that trigger the initiation of nodule formation on host legume roots.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

gi|15240922|ref|NP_198663.1| DNA repair protein RAD23, putative [Arabidopsis thaliana] gi|9758825|dbj|BAB09359.1| DNA... Match: gi|30409726|dbj|BAC76393.1| score: 335.5 e-value: 1.5e-90 Identity: 75.7% Span: 744bp (44.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

PROMOVE COMISIÓN DE NORMALIZACIÓN LINGÜÍSTICA DA ESCOLA POLITÉCNICA SUPERIOR DA USC. SERVIZO DE NORMALIZACIÓN LINGÜÍSTICA DA USC. SUBVENCIONA XUNTA DE GALICIA. CONSELLERÍA DE EDUCACIÓN E ORDENACIÓN UNIVERSITARIA. DIRECCIÓN XERAL DE POLÍTICA LINGÜÍSTICA. COORDINADOR XUSTO A.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

0 Introduction The tallgrass prairie ecosystem once spread across more than 60 million hectares and extended from southern Texas to southern Manitoba (Collins and Glenn 1998). Now, however, it is estimated that as little as 1-4% (0.6-2.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

bpg000270global_homology 3 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.- bpg000275global_homology 2 studiesConsensus:3.1.4.11GOIEAECglobal_homology Q5U791_XENLA Xenopus laevis (African clawed frog) 3.4.-.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

This list last updated July 19, 2002 Note: Assembly 1 was done on Jan 29, 2001. Assembly 2 was done on April 1, 2002. \N indicates that the EST is a singleton.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BLASTX 2.2.8 [Jan-05-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Using protein sequence data obtained from a calcium- and phospholipid-regulated protein kinase purified from maize (Zea mays), we isolated a cDNA encoding a calcium-dependent protein kinase (CDPK), which we designated ZmCPK11.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: [< Previous] 1 2 3 4 5 6 7 [Next >]



Valid XHTML 1.0 Transitional   Valid CSS