+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : sativa]
gi|485514|pir||S33621 ADR11-2 protein - soybean (fragment) gi|296443|emb|CAA49341.1| ADR11 [Glycine max] Match: gi|18396941|ref|NP_565348.1| score: 151 e-value: 3e-35 Identity: 84.15% Span: 246bp (21.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: Thrips species collected from areas in Australia surveyed for Caliothrips fasciatus. Date Location and State GPS Coordinates and Elevation Scientific Plant Name Thrips Species Collected 12/26/04 Brisbane International Airport; QLD S27o 24.166; E153o 06.492; 0m Peltophorum sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Fuchstraube, Wolfstraube sind das Solatrum bei Alexander. Serapion, Liber aggregatus, 67: Hameb. athahaleb vel hameb alchahaich id est uva vulpis et est solatrum. Nachtschatten-Gewchs.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 5
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Lettuce Crisphead Summertime, 'Lactuca sativa', is the most heat resistant head lettuce yet. Summertime is very sweet and has a far superior flav... more
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: distichon) 'Malt' barley - very young seedlings are dried to produce malt which contains enzymes that convert starch to sugars.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: frutescens - Tabasco Family Solanaceae Originated in Central America Came to United States in 1700s Black & white pepper used as seasoning is Piper nigrum. Tender, herbaceous perennials grown as annuals.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: distichon) 'Malt' barley - very young seedlings are dried to produce malt which contains enzymes that convert starch to sugars.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: 109. II (õ) ...
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Ĭ ɽ ν Ĺν . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 1. Allium ascalonicum L.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 172 22 AAAGCTCTTCATGGGAGCAA 59.955 20 228 4 231 GCGGGACACAGAACTTCTTTAC 60.172 22 GGAGCAACACCCTGAATGAT 59.934 20 215 4 218 GCGGGACACAGAACTTCTTTAC 60.172 22 ACATTTGCAGCCATTTCCTC 60.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: l-homocysteine and isoformononetin (4'-hydroxy-7-methoxyisoflavone) refined to 1.4 . These two OMTs constitute the first plant methyltransferases to be structurally characterized and reveal a novel oligomerization domain and the molecular determinants for substrate selection.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 113. Kulturplanter.
Kulturplanter - Av de ca. 275.000 planteartene vi kjenner er det bare et lite antall som kan karakteriseres som kulturvekster, viltvoksende eller i landbruk og hagebruk Mer utfyllende som pdf-fil (295 KB)
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: AC: RSP00001//OS: tomato (Lycopersicon esculentum) /GENE: pds/RE: Pds/Le element /BF: unknown nuclear factor 2. AC: RSP00002//OS: Brassica napus /GENE: Oleosin/RE: ABRE-3 /BF: B.napus embryo protein factor 3.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: 115. untitled.
Comparative Analysis of Expressed Genes from Cacao Meristems Infected by Moniliophthora perniciosa ABELMON S. GESTEIRA1 , FABIENNE MICHELI1,2 *, NICOLAS CARELS3, ALINE C. DA SILVA1!, KARINA P. GRAMACHO4, IVAN SCHUSTER5, JOCI N. MACE DO1, GONC ALO A. G. PEREIRA6 and JU LIO C. M.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: q'f iǐv '_v Laboratory of Environmental Stress Tolerance Mechanisms
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Braca, A. Bader, T. Siciliano, I. Morelli, N. De Tommasi, New pyrrolizidine alkaloids and glycosides from Anchusa strigosa, Planta medica, vol. 69, pp. 835-841, 2003 G. Flamini, P.L. Cioni, I. Morelli, Volatiles from leaves, fruits, and virgin oil from Olea europaea Cv.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: q'f iǐv '_v Laboratory of Environmental Stress Tolerance Mechanisms
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 119. Document.
456 21 CFR Ch. I (4103 Edition) 182.1 Subpart AGeneral Provisions 182.1 Substances that are generally recognized as safe. (a) It is impracticable to list all sub- stances that are generally recognized as safe for their intended use.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 120. untitled.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 A B C D E F G H I 21 Raphanus sativus Radish D'avignon www.johnnyseeds.com 620 mini $2.45 DS 26 Raphanus sativus Radish Cherriette www.johnnyseeds.com 2145 mini $2.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Pages: [<< First] [< Previous] 2 3 4 5 6 7 [Next >]
