Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
178 site(s)
PR 4
620 site(s)
PR 3
872 site(s)
PR 2
510 site(s)
PR 1
200 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : solanum]


Sort By :
Paprika Blühende Capsicum annuum Systematik Abteilung: Bedecktsamer (Magnoliophyta) Klasse: ...
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Die Gattung Paprika (Capsicum) gehört zur Familie der Nachtschattengewächse (Solanaceae). Verwandte Pflanzen sind etwa Kartoffeln (Solanum tuberosum) und Tomaten (Solanum lycopersicum)
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Weed management in domestic carrot production is characterized by high yield loss potential, few herbicides, and heavy reliance on handweeding. The most troublesome weed in carrot is volunteer potato and no herbicides are registered for control of the wee...
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BEAN | BEET | BROCCOLI | CABBAGE | CARROT | CAULIFLOWER | CRUCIFEROUS WEED | CUCUMBER | GARLIC | GREEN BEAN | LETTUCE | LIMA BEAN | ONION | PEA | PINTO BEAN | POTATO | PUMPKIN | RADISH | SPINACH | SQUASH | SWEET CORN | SWISS CHARD | TOMATO
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

A survey of weeds commonly found in irrigated carrot (Daucus carota L.) potato (Solanum tuberosum L.) and wheat (Triticum aestivum L.) in Sokoto Fadama (latitude 13o 01`N and longitude 5o 15`E) was carried out during 2001/2002 and 2002/2003 dry seasons.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Conventional, IP and organic: Most growers use 5-7 cm wide bands with double or triple rows. A spacing of 45 cm is mostly used between the bands beneath the tractor and 60 cm spacing is used for tractor wheeling.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

01. april 2006. For at imødekomme behovet hos såvel danske som udenlandske læsere er der medtaget 2 indholds- fortegnelser, der adskiller sig ved, at fortegnelsen over arterne er opstillet alfabetisk efter henholdsvis latinsk og dansk navn.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Bolivia: 1m, Santa Cruz, Santa Cruz, 17.8°S 63.1667°W, on sugar cane, 28 V 1980 (C. S. Pruett), (CNC). Brazil: 1m, Amazonas, Rio Negro, 29 IX 1976 (D. Toews), (CNC).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Biophysical Journal Volume 70 March 1996 1138-1143 Visualization of Plant Cell Walls by Atomic Force Microscopy Andrew R. Kirby, A. Patrick Gunning, Keith W. Waldron, Victor J.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

1 Institut für Agrikulturchemie Carl-Sprengel-Weg 1 Georg-August-Universität D-37075 Göttingen Göttingen Telefon: 0551 - 39 55 68 Fax: 0551 - 39 55 70 e-mail: uaac@gwdg.de Verzeichnis der Veröffentlichungen (List of publications) 2002 P Adgo, E. & Schulze, J.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

11. Nr.
Analyse, Kontrolle und Programmierung der Pflanzenproduktion in Gewächshäusern mit Hilfe beschreibender Modelle.II. Produktion von Radies (Raphanus sativus var. sativus).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

DATURA spp.: Borachero (Ch); Floripondio (P); Reina de la noche (P); Tonga (D) . The pith is used by Choco witch doctors to induce comas (!). The plants are used in folk "cures" for asthma, rheumatism, worms, inflammation, colds, fever, erysipelas, cramps, and infections.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

bstractThree kinds of explants from tubers cv Monalisa were analysed to investigate the time course of free and conjugated indole-3-acetic acid (IAA) concentrations, from the last period of tuber growth until sprouting, under two storage temperatures.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Abelmoschus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 111 Acacia . . . . . . . . . . . . . . . . . . . . . . CD-ROM, foraged species Acalypha . . . . . . . . . . . . . . . . . . . . . CD-ROM, minor species Aceratium . . . . . . . . . . . . . . . . . . .
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

{Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

(rat) 871,163 Ciona intestinalis 686,396 Xenopus laevis (African clawed frog) 677,784 Sus scrofa (pig) 641,896 Gallus gallus (chicken) 599,330 Drosophila melanogaster (fruit fly) 532,557 Hordeum vulgare + subsp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Florida, Hawaii (1858), Galapagos, South Africa (1858), Marquesas Islands (1924), Tahiti (1898), India (1807), Bangla Desh (1809), Sri Lanka (1821), Australia (1870), New Zealand (1830), USA, Canary Islands (1861), St.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

4. Listado de las especies que han obtenido protección en algún país del mundo. Explicación de lo símbolos usados en la tabla. Código de países.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pour chaque série, l'étudiant dispose de 3 minutes et doit donner, pour chaque plante, les noms latins, le nom vernaculaire et la famille (chacun des termes étant noté séparément).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: 1 2 3 4 [Next >]



Valid XHTML 1.0 Transitional   Valid CSS