Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6289
Biology: 170

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6601
Categories: 68
Registered Users: 120
Mailing List Subscribers: 26

+ Pagerank Statistics

PR 9
1 site(s)
PR 7
3 site(s)
PR 6
28 site(s)
PR 5
185 site(s)
PR 4
595 site(s)
PR 3
878 site(s)
PR 2
507 site(s)
PR 1
236 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : solanum]


Sort By :
PROTA 2: Vegetables / Légumes has been published in 2004 on-line in Protabase, in books and as CD-Rom (How we publish). It contains 275 review articles and describes 356 species; 106 review articles are in extended format (major species) and 159 are in reduced format (minor species).
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR:

Rubus spp. Rudbeckia hirta Rumex acetosa Rumex acetosella Rumex altissimus Rumex crispus Rumex maritimus var. persicarioides Rumex obtusifolius Rumex stenophyllus Salsola australis Salsola paulsenii Salsola pestifer Salvia officinallis Sarcobatus vermiculatus Schizachyrium scoparium Scirpus spp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Brackenridge Field Laboratory At the University of Texas at Austin 2907 Lake Austin Boulevard : Austin, TX 78703 : 512/471-2114 Vascular Plants of Brackenridge Field Laboratory (Updated 2005 ) FERNS POLYPODIACEAE Adiantum capillus-veneris (Southern Maidenhair) Cheilanthes alabamensis (Alabama
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Homo sapiens (human) 7,893,983 Mus musculus + domesticus (mouse) 4,720,064 Oryza sativa (rice) 1,188,565 Zea mays (maize) 1,143,728 Bos taurus (cattle) 1,137,353 Danio rerio (zebrafish) 1,134,553 Xenopus tropicalis 1,044,182 Rattus norvegicus + sp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Full protein sequences are available in table format, arranged alphabetically and by location in the tree below. H3s which are known or expected to be replication-coupled (RC) are separated from H3s which are known or expected to be replication-independent (RI).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

bstract Solanum phureja clone 1-3 and S. chacoense clone 80-1 have a zero and high leptine content in their foliage, respectively. An F1 hybrid (CP2) was intermedi- ate for the trait, but self-incompatible.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Die Gattung Paprika (Capsicum) gehört zur Familie der Nachtschattengewächse (Solanaceae). Verwandte Kulturpflanzenarten sind etwa Kartoffeln (Solanum tuberosum) und Tomaten (Solanum lycopersicum).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BoDD (Botanical Dermatology Database) monographs on plants of the SOLANACEAE that either cause or have been used to treat skin disease
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

BoDD (Botanical Dermatology Database) monographs on plants of the SOLANACEAE that either cause or have been used to treat skin disease
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pfeffer la pimienta roja, la pimienta rosa il pepe rosa, lo schino brasiliano, il pepe peruviano le poivre rose pink pepper, Peruvian pepper, pepper rosé Solanacea Capsicum annuum frisch, gross p'Pepëroni der Paprika, Gemüsepaprika el pimiento (morrón); mex.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Paprika Blühende Capsicum annuum Systematik Abteilung: Bedecktsamer (Magnoliophyta) Klasse: ...
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Die Gattung Paprika (Capsicum) gehört zur Familie der Nachtschattengewächse (Solanaceae). Verwandte Pflanzen sind etwa Kartoffeln (Solanum tuberosum) und Tomaten (Solanum lycopersicum)
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Impact of high-value agriculture and modern marketing channels on poverty: An analytical framework Nicholas Minot and Devesh Roy Markets, Trade, and Institutions Division International Food Policy Research Institute Washington, D.C.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Discover Life's encyclopedia page about the biology, natural history, ecology, identification and distribution of Tephritidae: Ceratitis capitata Wiedemann - Mediterranean fruit fly, Medfly
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

On a également isolé des souches sur aubergine (S. melongena) (Brioso et al., 1993) et Capsicum frutescens. De nombreuses autres espèces de Solanum (Fribourg et al., 1977) et de Solanacées sont infectées en conditions expérimentales.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Solanaceae Browallia Browallia americana L. Jamaican forget me not MA Calibrachoa Calibrachoa parviflora (Juss.) D'Arcy seaside petunia ME NH MA CT RI Capsicum Capsicum annuum L. cayenne pepper CT Datura Datura inoxia P. Mill. pricklyburr ME NH VT MA CT RI Datura stramonium L.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Environmental Specification: Lighting: Bulb: SON AGRO (430W) High Pressure Sodium (54,000 Lumens ~54,000 lux) Color Temperature = 2100K C.I.E. Coordinates: X=0.542, Y=0.
Details Hits: 5 Votes: 0 Ratings: Reviews: Google PR:

CSIRO PUBLISHING www.publish.csiro.au/journals/apdn Australasian Plant Disease Notes, 2007, 2, 9798 Solanum nigrum, a new host for powdery mildew disease of Capsicum annuum in the Madurai district of Tamil Nadu, India A. SudhaA,B and P.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Thai Pepper - (Capsicum annuum): other varieties are grown as well, including the jalapeño, serrano, etc. The Thai peppers are very hot (hotter than the jalapeño and serrano), which does not diminish when cooked.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: [< Previous] 1 2 3 4 [Next >]



Valid XHTML 1.0 Transitional   Valid CSS