Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168
Research: 792
Business: 40
Home Gardening: 100

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10

Pomology: Fruit Cultivation and Production
TropHort: Biology, Agriculture, Horticulture and Forestry
Producing Vegetable Crops 5th Edition by John M. Swiader.
Asparagus - Wikipedia, the free encyclopedia
Broccoli.
Microsoft Word - Bell pepper lesson.doc.
Texas A&M University System Research & Extension Center at Stephenville - Horticulture.
Veg&Fruit2007:Layout 1.
Alleviating malnutrition through agriculture in Bangladesh.
Life and Earth Sciences Social Network

   

+ Directory Statistics


Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
178 site(s)
PR 4
620 site(s)
PR 3
872 site(s)
PR 2
510 site(s)
PR 1
200 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : thaliana]


Sort By :
1. Carina Barth.
The small antioxidant vitamin C is important for human nutrition, because most animals, including humans, cannot synthesize AA. Important functions of the body, such as collagen biosynthesis, immune responses, pulmonary function, and iron absorption all require vitamin C.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR:

2. CEA Direction des sciences du vivant - iRTSV : Benoît Van der Rest.
Le métabolisme de la glycérophosphocholine chez les végétaux : caractérisation d'une glycérophosphodiester phosphodiestérase. Glycerophosphocholine metabolism in plant: Characterization of a new glycerophosphodiester phosphodiesterase.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

3. PGN - Sequence Details.
00: gb|AAM81202.1| calmodulin 1 [Medicago truncatula] gb|AAD53313.1| calmodulin 7 [Arabidopsis thaliana] emb|CAH57707.1| calmodulin [Quercus petraea] gb|AAM66013.1| calmodulin 7 [Arabidopsis thaliana] emb|CAA43143.1| Calmodulin [Malus x domestica] emb|CAB83153.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

4. Hh-i-3.
--- AAGAAGEN A.adeninivorans GAA gene for glucoamylase. --- (2769 bases) |SCO: 1.15|POS:2253-2378|MIS: 0|WOB: 1| |AGC|GAA|GU|.. 80 nuc ..|AC|C|ACA|CUCCUUCUUCUGGCCACA|UGU|CUGAAGA|GUU| --- AB005230 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone: MAC12, --- (74613 bases) |SCO: 1.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

5. CCGB BLAST Report Display.
minmatch = Minimum length of matching word required to nucleate SWAT comparison. minscore = Minimum alignment score minlength = Minimum size in basepairs of sequences of sequences selected for this assembly. For more information see: http://www.phrap.org/phrap.docs/phrap.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

6. Accession Numbers for CRKs Listed in Alignment Figure.
Accession Numbers for CRKs Listed in Alignment Figure (from Calcium-Dependent Protein Kinases and Their Relatives, Advances in Botanical Research, Volume 32, M. Kreis and J. C. Walker (eds.) Species CRK name Accession Number cDNA Genomic Arabidopsis thaliana (mouse-eared
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

7. ESTree: blast output page.
Query sequence: S39K5 (611 letters) Database: ./db/nr 2,304,535 sequences; 784,226,776 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM81202.1| calmodulin 1 [Medicago truncatula] >gi|5825598|gb...
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

8. !!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383...
!!SEQUENCE_LIST 1.0 (Peptide) FASTA of: seq.seq from: 1 to: 383 February 19, 1999 15:06 REFORMAT of: seq.seq check: 4199 from: 1 to: 383 February 19, 1999 15:04 (No documentation) TO: SwissProt:* Sequences: 71,248 Symbols: 25,831,459 Word Size: 2 Databases searched: SWISS-PROT, Release 35.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

9. Katherine DeGuire.
THE EFFECTS OF NMCP MUTATIONS ON NUCLEAR SIZE IN ARABIDOPSIS THALIANA. Katherine DeGuire1, Travis Dittmer1, Eric Richards1, Biology Department, Washington University, St Louis, MO1.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

10. Homology models For the WD DOMAIN.
Domain architecture information on representative(s) of the 44 S60 cluster(s) of the current cluster.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

11. Texas Tech University :: Department of Biological Sciences.
Drought conditions affect an estimated 25% of crops with a corresponding decrease in productivity estimated worldwide to be worth US$10 billion/yr. Reclamation of arable land of marginal quality will result in crops that increasingly experience salt stress.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

12. XcisClique: View cis-Element.
CharacteristicTypecisIDDPBFCOREDCDC3Annotation"A novel class of bZIP transcription factors, DPBF-1 and 2 (Dc3 promoter-binding factor-1 and 2) binding core sequence; Found in the carrot (D.c.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

13. Selected Genes.
factormedian_fitted_datamedian_fitted_datagene annotationgene annotation condition1condition0(CONTROL)condition1functional categorydescription VBVHG06?
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

14. a2m2html output for file tmp.a2m.
(c) 1992-2000 Regents of the University of California, Santa Cruz Sequence Alignment and Modeling Software System http://www.cse.ucsc.edu/research/compbio/sam.html
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

15. Seq_Name Matching_Seq Putative_Function SSR_Num SSR_Type SSR SSR_size...
{Lycopersicon esculentum;} ^|^PIR|S42542|S42542 ripening-associated membrane protein (clone pNY507) - tomato {Lycopersicon esc-TRUNCATED- 1 p1 (A)12 12 161 172 CCACTATAAAACAACCACAACCC 59.569 23 GACAACTCCCCTGGTTCAAA 59.943 20 254 79 332 CCACTATAAAACAACCACAACCC 59.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

16. >chloroplast
| chloroplast.|-!- subcellular location: chloroplast. MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAIM >peroxisome Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

17. BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L....
BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

18. >K0_1 No match I:0 Q:0 S:0 Full:0...
>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

19. Internationale biometrische gesellschaft société internationale de...
, Konto-Nummer: 847 58 - 672, BLZ: 545 100 67 Rundschreiben 3 / 2000 November 2000 Internationale Biometrische Gesellschaft - Deutsche Region: Rundschreiben 3/2000 2 Inhalt - Grußworte 3 - Bericht vom IBS-Council-Meeting 6.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

20. Abstracts of the next SIFV Congress.
Arbuscular mycorrhizal (AM) fungi form symbiotic associations with most land plants and promote the growth of the host through enhanced uptake of phosphorus.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: 1 2 3 4 5 [Next >]


Home   New Listings   Hot Listings   Top Rated   Editor Pick   Add a Listing   Upgrade a Listing   Update a Listing   Get Rated   Suggest a Category
Copyright © 2008 Olericulture.org. All Rights Reserved.

Valid XHTML 1.0 Transitional   Valid CSS