+ Main Category
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'
+ Top 10
+ Directory Statistics
Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : truncatula]
>K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: 
Reviews: 
Google PR: In vivo Lokalisierung von strukturellen und regulatorischen Komponenten von COPI-coated Vesikeln in Medicago truncatula cv. Jemalong Wurzelzellen Dissertation zur Erlangung des akademischen Grades Doktor der Naturwissenschaften (Dr. rer. nat.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: This page was last modified Sept. 13, 2006. A link to P450 functions in plants an extensive listing with references. From the Plant Biotechnology Institute, National Research Council, Saskatoon, Saskatchewan CANADA Plant P450s that have appeared since the 1993 P450 nomenclature update.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >K0_1 No match I:0 Q:0 S:0 Full:0 LDISSLFLYEYEMLYDSCLTTTKIYYSKQTLIQKKKKKKKXXX >K0_3 UniRef90_Q93YG7 Cluster: Profilin-2; n=4; Solanaceae|Rep: Profilin-2 - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) I:85 Q:90.8450704225352 S:98.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: FASTA searches a protein or DNA sequence data bank version 3.3t07 Sept. 19, 2000 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 At1g12220.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
