Home India Indonesia Taiwan Kenya Thailand Vietnam
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Crops: 6288
Biology: 168

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'Olericulture: Vegetable Cultivation and Production'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 6598
Categories: 68
Registered Users: 104
Mailing List Subscribers: 25

+ Pagerank Statistics

PR 7
2 site(s)
PR 6
27 site(s)
PR 5
178 site(s)
PR 4
620 site(s)
PR 3
872 site(s)
PR 2
510 site(s)
PR 1
200 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : virus]


Sort By :
By knocking out a gene, researchers are better able to study the function of the inactivated gene. One way to accomplish this inactivation is by using a knockout vector. Knockout plants can aid scientists in a variety of areas, including disease resistance.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus peptidase (A3) NPNSIYIKGKLYFKGYKAYSLHCYVDTGASLCIASKKIIPEEYWENAKKPIEVKIANGSIITITKVCSNLFLKIAGKRFL IPTVYQQESGIDLILGNNFCKLYNPFIQYLDRIEFHKKNLEPVEIKKITKAILVGNEGFLESMKKISKTQQPYPFNITIN TIQLEEICSINPGDEEKLFNTIIIKIQLIEPLLEKVCSENP
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

promoter, which is known to be one of the most potent promoters in mammalian cells. The 35S promoter must therefore be considered to be a promoter of significant potency in mammalian cells.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Department of Plant Pathology, University of California Davis, CA 95616, USA 2Department of Bacteriology, University of California Davis, CA 95616, USA 1To whom reprint requests should be addressed. Received April 21, 1981.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

*Address all correspondence to: Dr. Stephen H.Howell, c/o Laboratory of Dr. W.J.Peacock, CSIRO, Division of Plant Industry, P Box 1600, Canberra City, ACT 2601, Australia Received July 27, 1983. Revised December 15, 1983. Accepted December 15, 1983.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The human Hepatitis B virus (HBV) is the type member of the hepadnaviruses, animal infecting pararetroviruses (Nassal and Schaller, 1993; Seeger and Mason, 2000).
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Nutmegs - contamination with aflatoxins. Study for the evaluation of raw material. 17 - Performance of sampling plans to determine aflatoxin in farmers' stock peanut lots by measuring aflatoxin in high-risk-grade components.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The majority of crop plant constructions for herbicide or disease resistance employ a Promoter from cauliflower mosaic virus (CaMV). Regardless of the gene transferred, all transfers require a promoter, which is like a motor driving production of the genes' message.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The genetic engineering community has assumed that Agrobacterium, a commonly used gene transfer vector for plants, does not infect animal cells, and certainly would not transfer genes into them. But this has been proved wrong. Prof. Joe Cummins warns of hazards to laboratory and farm workers.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Your browser does not support frames. Click here to view the unframed reprint.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The CaMV promoter gene has been found to be a "hot spot" for recombination leading to exchange of gene sequences at elevated frequency (Ho et al Microbial Ecology in Health and Disease (no.4,1999)..
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Description of 00.015.0.01.001. Cauliflower mosaic virus, generated from ICTVdB, a DELTA database
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Your browser does not support frames. Click here to view the unframed reprint.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Virus Code. 15.0.1.0.004. Virus Accession number 15010004. Synonym(s): brassica virus 3, broccoli mosaic virus, cabbage mosaic virus, cabbage virus B. Approved acronym: CaMV. Virus infects plants. Description is on taxonomic level of species. Virus is the type species of the genus.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

This file is in Adobe Acrobat (PDF) format. If you have not installed and configured the Adobe Acrobat Reader on your system, see Help with Printing for instructions.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Every year, viruses cause billions of dollars of damage to crops around the world. For this reason, it is important to acquire a more detailed understanding of how viruses work.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Your browser does not support frames. Click here to view the unframed reprint.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Definition of recombination: covalent joining of of DNA or RNA segments that are normally not adjacent. It can occur either by cleavage and ligation (cut and paste), or in the case of RNA recombination, but a switch in the template used by the RNA polymerase during RNA synthesis.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: [< Previous] 1 2 3 4 5 6 7 [Next >]



Valid XHTML 1.0 Transitional   Valid CSS